KEGG   Burkholderia cepacia GG4: GEM_0526Help
Entry
GEM_0526          CDS       T02205                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00071  Fatty acid degradation
bct00280  Valine, leucine and isoleucine degradation
bct00281  Geraniol degradation
bct00310  Lysine degradation
bct00360  Phenylalanine metabolism
bct00362  Benzoate degradation
bct00380  Tryptophan metabolism
bct00410  beta-Alanine metabolism
bct00627  Aminobenzoate degradation
bct00640  Propanoate metabolism
bct00650  Butanoate metabolism
bct00903  Limonene and pinene degradation
bct00930  Caprolactam degradation
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
bct01130  Biosynthesis of antibiotics
bct01212  Fatty acid metabolism
Module
bct_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GEM_0526
   00650 Butanoate metabolism
    GEM_0526
  Lipid metabolism
   00071 Fatty acid degradation
    GEM_0526
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GEM_0526
   00310 Lysine degradation
    GEM_0526
   00360 Phenylalanine metabolism
    GEM_0526
   00380 Tryptophan metabolism
    GEM_0526
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GEM_0526
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GEM_0526
   00281 Geraniol degradation
    GEM_0526
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GEM_0526
   00627 Aminobenzoate degradation
    GEM_0526
   00930 Caprolactam degradation
    GEM_0526
Enzymes [BR:bct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GEM_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 TAF
Motif
Other DBs
NCBI-ProteinID: AFQ46977
UniProt: J7IYP1
Position
1:587843..588670
Genome map
AA seq 275 aa AA seqDB search
MADLSAYGGYEALKVTRRDHGVLDIVMSGEGANRSGLATANERMHRELADIWRDVDRDPD
TRVAVIRGEGKGFSAGGDLALVEAMANDFDVRARVWREARDLVYNVINCSKPIVSAMHGP
AVGAGLVAGLLADISIAAKDARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYLLLCEP
VSGEEAERIGLVSLAVEPADLLPKAYEVAERLAHGSQSAIRWTKYALNNWLRSAGPTFDT
SLALEFMGFSGPDVQEGIRSLRERRPPDFPGDAPF
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggccgatctttccgcatacggcgggtacgaagcactgaaggtgacacgccgcgatcat
ggcgtgctcgacatcgtgatgagcggcgagggcgcgaaccgcagcggcctcgcgaccgcg
aacgaacgcatgcatcgcgagctcgccgacatctggcgtgacgtcgaccgcgatcccgat
acgcgcgtcgcggtgatccgcggcgagggcaagggcttttcggcgggcggcgatctcgcg
ctcgtcgaggcgatggccaacgacttcgacgtgcgcgctcgcgtgtggcgcgaggcgcgc
gacctcgtctacaacgtgatcaactgcagcaagccgatcgtgtcggcgatgcacggcccg
gcggtcggtgcggggctcgtcgccgggctgctcgccgacatctcgatcgccgcgaaggat
gcgcgcatcatcgacggccatacgcggctcggcgtcgcggccggcgatcatgcggcgatc
gtgtggccgctgttgtgcgggatggcgaaggcgaagtactacctgctgctgtgcgagccg
gtgagcggcgaggaggccgagcggatcggactcgtgtcgctcgcggtcgagccggccgac
ctgctgccgaaggcgtacgaggtggccgagcggctcgcgcacggctcgcagtcggcgatc
cgctggaccaagtacgcgctgaacaactggctgcgctcggccgggccgaccttcgatacg
tcgctcgcgctcgaattcatgggcttctcggggcccgacgtgcaggaaggcatccgttcg
ctgcgcgagcggcgcccgcccgacttccccggcgacgcaccgttctga

DBGET integrated database retrieval system