KEGG   Burkholderia cepacia: GEM_0639Help
Entry
GEM_0639          CDS       T02205                                 

Definition
Ipk protein (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bct  Burkholderia cepacia
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bct00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(706806..707687)
Genome map
AA seq 293 aa AA seqDB search
MTDSTRSLRNCLAPAKLNLFLHITGRRPNGYHDLQSVFQLLNWGDTLHFTLRDDGRVARV
TDVPGVPEESDLVVRAANLLKTHTGTAAGVDIEIDKCLPMGAGLGGGSSDAATTLLALNR
LWQLDLPRAELQSLAVKLGADVPFFVFGKNAFAEGIGEELAEVQLPTRWFLVVTPRVHVP
TAEIFSDKLLTRDTKRVTITDFLAQQNSDAGWPDSFGRNDMQQVVTSKYAEVAQVVKWLY
DVTPARMTGSGASVFAAFHSKHEAEAAKAKLPTGWNGAVAESLNEHPLFTFAS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgacccgctcgctgcgcaactgccttgcgcccgcgaaactcaacctgttc
ctgcacatcaccggccgccgcccgaacggctatcacgatctgcagagcgtgttccagctg
ctgaactggggcgatacgctgcacttcacgctgcgcgacgacggtcgcgtcgcacgcgtc
accgacgtgccgggcgtgcccgaggaaagcgatctcgtcgtgcgcgcggccaacctgctg
aagacgcacaccggtaccgcagccggcgtcgacatcgagatcgacaagtgcctgccgatg
ggcgcgggcctcggcggcggcagctccgacgcggcgacgacgctgctcgcgctgaaccgc
ctgtggcaactcgacctgccgcgtgcggaactgcaatcgctcgcggtgaaactcggcgca
gacgtcccgttttttgtttttggaaaaaatgcgttcgcagagggtatcggagaagaatta
gctgaggtacaattgccgactcgctggttcttggttgtaacgccgcgagttcatgtccca
accgctgaaattttttcagataagttgttgacaagagatacgaagcgagtcacaattaca
gactttcttgcacagcaaaacagcgatgcgggatggccagacagcttcggccggaacgac
atgcagcaagttgtgacaagtaagtacgcggaagttgcgcaggtggtcaaatggttgtat
gatgtgacccccgcgaggatgaccggctccggagcaagcgtgtttgcggcgtttcatagc
aagcacgaggcagaagcggcgaaagccaagctgcccaccggttggaacggtgcagttgcc
gagagcttgaacgagcatccgctcttcactttcgcgtcatga

DBGET integrated database retrieval system