KEGG   Burkholderia cepacia GG4: GEM_0788Help
Entry
GEM_0788          CDS       T02205                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bct  Burkholderia cepacia GG4
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GEM_0788
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GEM_0788
   00640 Propanoate metabolism
    GEM_0788
   00660 C5-Branched dibasic acid metabolism
    GEM_0788
Enzymes [BR:bct01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GEM_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:871389..872555
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMVEEGADIKQELYVSLVVDRVTQK
IVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQADDLAAKIGVPAASIPQARAI
LQGLYKAFWETDASLAEINPLNVAGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPDLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LADSGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggttgacgaggccgtcaaggtggcagaagagctgggcggc
ccggtgtgggtcgtgaaggctcagattcacgcgggtggccgtggcaagggcggcggcgtg
aaggtggcgaagtcgatcgagcaggttcgcgaatacgcgaaccagatcctcggcatgcag
ctcgtcacgcaccagaccggcccggaaggccagaaggtcaaccgtctgatggtcgaagaa
ggcgccgacatcaagcaggaactgtatgtcagcctcgtcgtcgatcgcgtgacgcagaag
atcgttctgatgggttcgagcgaaggcggcatggacatcgaggaagttgcggaaaagcac
ccggaactgatccacaaggtcatcgtcgagccgtcgacgggcctgctcgacgcgcaagct
gacgacctcgccgcgaagatcggcgtgccggctgcttcgattccgcaagcacgcgcgatc
ctgcaaggcctgtacaaggcattctgggaaaccgacgcatcgctggctgaaatcaacccg
ctgaacgtcgccggcgacggcaaggtcatcgcactcgacgcgaagttcaacttcgactcg
aacgcgctgttccgccacccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgtctcgtgaacggcgcaggcctcgcgatggcgacgatggacacgatcaagctgttcggc
ggcgagccggcgaacttcctggacgtcggcggtggcgcgacgaccgagaaggtcaccgaa
gcgttcaagctgatgctgaagaacccggacctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgccggttcgaaggccgtgaac
ctgaacgtgccgctcgtcgtgcgcatgaagggcacgaacgaggacctcggcaagaagatg
ctggccgattcgggcctgccgatcatctccgctgacagcatggaagaagctgcgcagaag
gtcgtcgcggctgccgcaggcaagtaa

DBGET integrated database retrieval system