KEGG   Burkholderia cepacia GG4: GEM_0788Help
Entry
GEM_0788          CDS       T02205                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00020  Citrate cycle (TCA cycle)
bct00640  Propanoate metabolism
bct00660  C5-Branched dibasic acid metabolism
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
bct01130  Biosynthesis of antibiotics
bct01200  Carbon metabolism
Module
bct_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bct_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GEM_0788
   00640 Propanoate metabolism
    GEM_0788
   00660 C5-Branched dibasic acid metabolism
    GEM_0788
Enzymes [BR:bct01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GEM_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp K-cyclin_vir_C
Motif
Other DBs
NCBI-ProteinID: AFQ47236
UniProt: J7J8H6
Position
1:871389..872555
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMVEEGADIKQELYVSLVVDRVTQK
IVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQADDLAAKIGVPAASIPQARAI
LQGLYKAFWETDASLAEINPLNVAGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPDLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LADSGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggttgacgaggccgtcaaggtggcagaagagctgggcggc
ccggtgtgggtcgtgaaggctcagattcacgcgggtggccgtggcaagggcggcggcgtg
aaggtggcgaagtcgatcgagcaggttcgcgaatacgcgaaccagatcctcggcatgcag
ctcgtcacgcaccagaccggcccggaaggccagaaggtcaaccgtctgatggtcgaagaa
ggcgccgacatcaagcaggaactgtatgtcagcctcgtcgtcgatcgcgtgacgcagaag
atcgttctgatgggttcgagcgaaggcggcatggacatcgaggaagttgcggaaaagcac
ccggaactgatccacaaggtcatcgtcgagccgtcgacgggcctgctcgacgcgcaagct
gacgacctcgccgcgaagatcggcgtgccggctgcttcgattccgcaagcacgcgcgatc
ctgcaaggcctgtacaaggcattctgggaaaccgacgcatcgctggctgaaatcaacccg
ctgaacgtcgccggcgacggcaaggtcatcgcactcgacgcgaagttcaacttcgactcg
aacgcgctgttccgccacccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgtctcgtgaacggcgcaggcctcgcgatggcgacgatggacacgatcaagctgttcggc
ggcgagccggcgaacttcctggacgtcggcggtggcgcgacgaccgagaaggtcaccgaa
gcgttcaagctgatgctgaagaacccggacctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgccggttcgaaggccgtgaac
ctgaacgtgccgctcgtcgtgcgcatgaagggcacgaacgaggacctcggcaagaagatg
ctggccgattcgggcctgccgatcatctccgctgacagcatggaagaagctgcgcagaag
gtcgtcgcggctgccgcaggcaagtaa

DBGET integrated database retrieval system