KEGG   Burkholderia cepacia GG4: GEM_0923Help
Entry
GEM_0923          CDS       T02205                                 

Definition
(RefSeq) stearoyl-CoA desaturase (EC:1.14.19.1)
  KO
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bct  Burkholderia cepacia GG4
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    GEM_0923
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    GEM_0923
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     GEM_0923
Lipid biosynthesis proteins [BR:bct01004]
 Desaturase
  First
   GEM_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1021043..1022236
Genome map
AA seq 397 aa AA seqDB search
MLNSLLDFLSHGLLRFSWWQVALFALAVTHVTIIGVTVYLHRCQAHRALELHPIASHFFR
VWLWMTTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKVFLEGAELYRAEAKNEETM
RKFSHGTPNDWIERNVYSKYPILGISLMMVIDVALFGVLGLTVWAVQMVWIPFWAAGVVN
GFGHFWGYRNFNSADASTNLFPWGIVIGGEELHNNHHTFATSAKLSNKWYEFDIGWMYIR
IMSAFGLAKVKKVAPTPRLNKPKTVLDQETLQAVLSNRYEVMARYGKAVKRAYRQELAHL
KEIGGEKYQLMRGARKWFHKDADGLDEPQKKLLPEIFANSQKLHTYFQLRQDLAAIWDRS
TASREQLLAQLQDWCHRAEQSGIKSLQEFATRLRRYA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaattccctgctcgattttctttcccacgggcttctgcgcttttcgtggtggcag
gtcgcgctgttcgcgctggccgtcacgcacgtcacgatcatcggcgtgacggtctacctg
catcgctgccaggcgcaccgcgcgctggagctgcatccgatcgcgagccacttcttccgc
gtctggctgtggatgacgaccggcatgctgacgggccagtgggccgcgatccatcgcaag
caccacgcgaagtgcgaaaccgaggaagatccgcacagcccgcagacgcgtgggatctgg
aaggtgttcctcgaaggcgccgagctgtatcgcgcggaagcgaagaacgaagaaacgatg
cgcaagttcagccacggcacgccgaatgactggatcgagcgcaatgtgtactcgaagtac
ccgattctcggcatcagcctgatgatggtgatcgacgtcgcgctgttcggcgtgctcggc
ctgaccgtgtgggccgtgcagatggtctggattccgttctgggcggctggcgtcgtcaac
ggcttcggccacttctggggctaccgcaacttcaactcggccgacgcgagcacgaacctg
ttcccgtggggcatcgtgatcggcggcgaagagctgcacaacaaccaccacacgttcgcg
acgtcggcgaagctgtcgaacaagtggtacgagttcgacatcggctggatgtacatccgc
atcatgtcggcattcggtctcgcgaaggtgaagaaggttgcgccgacgccgcgcctgaac
aagccgaagacggtgctcgaccaggaaacgctgcaggccgtgctgtcgaaccgctacgaa
gtgatggcgcgctacggcaaggccgtgaagcgcgcatatcgccaggagctcgcgcacctg
aaggaaatcggcggcgagaagtaccagctgatgcgcggcgcgcgcaagtggttccacaag
gacgccgacggcctcgacgagccgcagaagaagctgctgccggagatcttcgcgaacagc
cagaagctgcacacgtacttccagctccgccaggatctcgccgcgatctgggatcgttcg
accgcgtcgcgcgaacagcttctcgcgcaattgcaggattggtgccatcgcgcagaacaa
agcggcatcaagtcgctgcaggaattcgcgacgcgcctgcgccgctacgcctga

DBGET integrated database retrieval system