KEGG   Burkholderia cepacia GG4: GEM_0963Help
Entry
GEM_0963          CDS       T02205                                 

Definition
DNA polymerase III chi subunit HolC (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bct  Burkholderia cepacia GG4
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GEM_0963
   00240 Pyrimidine metabolism
    GEM_0963
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    GEM_0963
   03430 Mismatch repair
    GEM_0963
   03440 Homologous recombination
    GEM_0963
Enzymes [BR:bct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     GEM_0963
DNA replication proteins [BR:bct03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     GEM_0963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1057519..1057935
Genome map
AA seq 138 aa AA seqDB search
MTRIDFHSNVGDSLAYACRLLRKAYLAGQPVVVLAEPARLRALDEQLWTFSPLDFIPHCG
VDSAHAAGTPIVLTADLDQAPHHHVLLNLGAAVPAQFARFERLLEVVGNAPDELAAGRDR
YRFYRDRGYALNNYKQGS
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgaatcgatttccattcgaacgtcggcgattcgctcgcgtacgcgtgccggctg
ctgcgcaaggcctacctggccgggcagccggtcgtcgtgctcgcggaacccgcgcgcttg
cgcgcactcgacgagcagctctggacgttttcgccgctcgatttcatcccgcattgcggc
gtcgacagcgcgcacgcggccggcacgccgatcgtgctgaccgccgacctcgaccaggcg
ccgcatcatcacgtgctgctgaacctcggcgcggccgtgcccgcgcagttcgcccgcttc
gagcgcctgctcgaagtggtcggcaatgcgccggacgagctggccgcgggccgcgaccgc
taccgcttctaccgcgatcgcggatacgcgctgaacaactacaagcagggcagctga

DBGET integrated database retrieval system