KEGG   Burkholderia cepacia GG4: GEM_1007Help
Entry
GEM_1007          CDS       T02205                                 

Definition
(GenBank) protein of unknown function DUF513 hemX
  KO
K13543  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00860  Porphyrin and chlorophyll metabolism
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GEM_1007
Enzymes [BR:bct01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     GEM_1007
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GEM_1007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemX HEM4 V_ATPase_I
Motif
Other DBs
NCBI-ProteinID: AFQ47454
UniProt: J7J524
Position
1:1104328..1106298
Genome map
AA seq 656 aa AA seqDB search
MAGGARAFTAVLTRPDGQSAALAAQLADAGCDVLEFPLIDIAPVADAAPLDAAFAALADY
ALVIFVSPNAIDRALAQYGAIWPNALPVGVVGPGSVAALERHGIAAPAHRVIAPQAPADG
GVPRYDSESLFASIEAAFGGAHALADKRVLIVRGDGGREWLAERLREAGADVTLVAAYRR
VVPEPRVGTWERVHALLAGAPHAWLVTSSEGVRNLHELARTHLNDAEIGALKHVPLVTPH
PRIEQTARALGFDRITLTGAGDERIVRAFRTMADEAVQPATAAPVTKRMTDTNDSKRVAS
QPAAASAPPSSPPYLASEPHARRGGSAALWFVVVVLGCAAGVGGYALNRKVDRLDDSFVA
RQKALDAQTAETRMKTEQALASTHQVDTQLAQLDGKLADAQSAQQALQQQYQDLSRNRDA
WMLEEVDQMLSSASQQLQLTGNTQLALIALQNADARLATSQSAQAVTVRKALAQDIEKLK
AAPSADLTGLAIKLDDAIAKIDALPLSGEAIVPHAVPKAAPADAASPAAPDAPRWKAWWH
DFSAGLGQQLKGLVQVRRIDNADAMLASPDQGYFVRENVKLRLLTARLSLLARNDGAMKA
DLHAAQASLGKYFDHASKDTQSVEDLLKQVDSASLTVAVPNLNTSLNAVQQFKSRG
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcggcgcgcgcgcgttcaccgccgtcctgacgcgtccggacggccagtcggcc
gcgctcgcggcacagctggccgacgccggctgcgacgtgctcgaattcccgctgatcgac
atcgcgccggtcgccgatgcggcgccgctcgacgcggcgttcgcggcgctggccgactac
gcgctcgtgatcttcgtgtcgccgaacgcgatcgaccgcgcgctcgcgcagtacggcgcg
atctggccgaatgcgctgccggtcggcgtcgtcgggcccggcagcgtcgcggcgctggag
cgccacggcatcgcggcgcccgcgcatcgcgtgatcgcgccgcaggcgcccgccgacggc
ggcgtgccccgttacgattcggaaagcctgttcgcgagcatcgaggccgcgttcggcggc
gcgcacgcgctcgccgacaagcgcgtgctgatcgtgcgcggcgatggcggccgcgaatgg
ctcgccgagcggctgcgcgaagccggcgcggacgtcacgctggtcgccgcataccggcgc
gtcgtgcccgagccgcgcgtcggcacgtgggaacgcgtgcatgcgctgctcgccggcgcg
ccgcacgcgtggctcgtcacgagctcggagggcgtgcgcaacctgcacgaactcgcgcga
acccatctgaacgacgcggagatcggcgcgctgaagcatgtgccgctcgtgacgccgcac
ccgcgcatcgagcagaccgcgcgggcattgggttttgataggattacgctgaccggcgcg
ggcgatgagcgcatcgtccgcgcgtttcgaacgatggccgacgaggccgtccaaccggcg
acagccgcaccggtgactaaacgcatgacagataccaacgattccaaacgcgtcgcttcc
cagccggccgctgcctccgcaccgccgtccagtcccccttatctcgcgtccgaaccgcat
gcacgccgcggcggcagcgcggcgctgtggttcgtcgtcgtcgtgctgggctgcgcggcg
ggcgtcggcggctatgcgctgaaccgcaaggtcgaccggctcgacgattcgttcgtcgcg
cgccagaaggcgctcgatgcgcagacggccgagacccgcatgaagaccgagcaggcgctc
gcgagcacgcaccaggtcgacacgcagctcgcgcagctcgacggcaagctcgccgacgcg
cagagcgcgcagcaggcgctgcagcagcaataccaggacctgtcgcgcaaccgcgacgcg
tggatgctcgaggaagtcgatcagatgctgtcgagcgcgagccagcagctgcagctcacc
ggcaacacgcaactcgcgctgatcgcgctgcagaatgccgacgcgcgcctcgcgacgtcg
cagagcgcgcaggccgtcacggtgcgcaaggcgctcgcgcaggacatcgagaagctgaag
gccgcgccgtcggccgacctcacgggcctcgcgatcaagctcgacgacgcaatcgcgaag
atcgacgcgctgccgctgtcgggcgaggcgatcgtcccgcatgcggtgccgaaggccgcg
ccggccgacgccgcgtcgccggccgcgcccgacgcgccgcgctggaaggcgtggtggcat
gacttctcggccggcctcggccagcagttgaagggcctcgtgcaggtgcgccggatcgac
aacgccgacgcgatgctcgcgtcgcccgaccagggctacttcgtacgcgagaacgtgaag
ctgcgcctgctcaccgcgcggctgtcgctgctcgcacgcaacgacggcgcgatgaaggcc
gacctgcacgccgcgcaggcgtcgctcggcaagtatttcgaccacgcatcgaaggacacg
caatccgtcgaggatctgctcaagcaggtcgacagcgcatcgctgacggtcgcggtgccg
aacctgaacacgagcctgaacgccgttcagcagttcaagagccgggggtaa

DBGET integrated database retrieval system