KEGG   Burkholderia cepacia GG4: GEM_1159Help
Entry
GEM_1159          CDS       T02205                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00010  Glycolysis / Gluconeogenesis
bct00051  Fructose and mannose metabolism
bct00562  Inositol phosphate metabolism
bct00710  Carbon fixation in photosynthetic organisms
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
bct01130  Biosynthesis of antibiotics
bct01200  Carbon metabolism
bct01230  Biosynthesis of amino acids
Module
bct_M00002  Glycolysis, core module involving three-carbon compounds
bct_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GEM_1159
   00051 Fructose and mannose metabolism
    GEM_1159
   00562 Inositol phosphate metabolism
    GEM_1159
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    GEM_1159
Enzymes [BR:bct01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GEM_1159
Exosome [BR:bct04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GEM_1159
  Exosomal proteins of bladder cancer cells
   GEM_1159
  Exosomal proteins of melanoma cells
   GEM_1159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFQ47604
UniProt: J7J5H4
Position
1:1266438..1267193
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGAVAAETSIGVCVPFPYLAQVQAQLGG
GRVAFGAQDVSAHEQGAFTGEVAAAMVAEFGAHYTIVGHSERRAYHGERNETVAAKTQRA
LAAGLTPVVCVGETLDEREAGATEQVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRARLVAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
EDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgttgctgaacgaagtggtgcagggcgcgggcgcggtggcggctgaaacg
tcgatcggcgtgtgcgtgccgttcccgtatctcgcgcaggttcaggcgcagcttggcggc
ggccgtgtcgcgttcggtgcgcaggacgtgtccgcgcacgagcagggcgcgttcaccggc
gaagtcgcggctgcgatggttgcggaattcggcgcgcactatacgatcgtcggtcactcg
gagcgtcgcgcatatcacggcgaacgcaacgagacggtcgccgcgaagacgcagcgcgcg
ctcgcggccggcctcacgcccgtcgtgtgcgtcggcgagacgctcgacgagcgcgaagcg
ggtgcgaccgagcaggtggtcggtgcgcagctcgacgccgtgctggccgtgctgacggct
gacgaggcggcacgcatcgtcgtcgcgtacgagccggtctgggcgatcggcacgggcaag
agcgcgacgtcggcgcaggcgcaggatgtgcacgcgttcctgcgtgcgcgtctcgtggcg
aagggcgcggcggacgtgtccgtgctgtatggcggcagcgtgaagccggacaacgcggaa
gagctgtttgcgcagccggacatcgacggcggcctgatcggcggtgcgtcgttgaaggcg
gaagatttcctggcgatctgccgggccgcacgttga

DBGET integrated database retrieval system