KEGG   Burkholderia cepacia: GEM_1159Help
Entry
GEM_1159          CDS       T02205                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bct  Burkholderia cepacia
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:bct01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bct01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bct00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bct00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bct00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:bct00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1266438..1267193
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGAVAAETSIGVCVPFPYLAQVQAQLGG
GRVAFGAQDVSAHEQGAFTGEVAAAMVAEFGAHYTIVGHSERRAYHGERNETVAAKTQRA
LAAGLTPVVCVGETLDEREAGATEQVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRARLVAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
EDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgttgctgaacgaagtggtgcagggcgcgggcgcggtggcggctgaaacg
tcgatcggcgtgtgcgtgccgttcccgtatctcgcgcaggttcaggcgcagcttggcggc
ggccgtgtcgcgttcggtgcgcaggacgtgtccgcgcacgagcagggcgcgttcaccggc
gaagtcgcggctgcgatggttgcggaattcggcgcgcactatacgatcgtcggtcactcg
gagcgtcgcgcatatcacggcgaacgcaacgagacggtcgccgcgaagacgcagcgcgcg
ctcgcggccggcctcacgcccgtcgtgtgcgtcggcgagacgctcgacgagcgcgaagcg
ggtgcgaccgagcaggtggtcggtgcgcagctcgacgccgtgctggccgtgctgacggct
gacgaggcggcacgcatcgtcgtcgcgtacgagccggtctgggcgatcggcacgggcaag
agcgcgacgtcggcgcaggcgcaggatgtgcacgcgttcctgcgtgcgcgtctcgtggcg
aagggcgcggcggacgtgtccgtgctgtatggcggcagcgtgaagccggacaacgcggaa
gagctgtttgcgcagccggacatcgacggcggcctgatcggcggtgcgtcgttgaaggcg
gaagatttcctggcgatctgccgggccgcacgttga

DBGET integrated database retrieval system