KEGG   Burkholderia cepacia GG4: GEM_1224Help
Entry
GEM_1224          CDS       T02205                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00010  Glycolysis / Gluconeogenesis
bct00620  Pyruvate metabolism
bct00640  Propanoate metabolism
bct00680  Methane metabolism
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
bct01130  Biosynthesis of antibiotics
bct01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GEM_1224
   00620 Pyruvate metabolism
    GEM_1224
   00640 Propanoate metabolism
    GEM_1224
  Energy metabolism
   00680 Methane metabolism
    GEM_1224
Enzymes [BR:bct01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GEM_1224
Lipid biosynthesis proteins [BR:bct01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GEM_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFQ47663
UniProt: J7J8P6
Position
1:1326728..1328731
Genome map
AA seq 667 aa AA seqDB search
MFTKGLSMSAIESVLHETRQFAPPEALEKAATISGMPAYRALAAEAERDYEGFWGRLARE
GLSWHKPFTKVLDESDAPFYKWFDDGELNASYNCLDRHVEAGNGERVAVIFEADDGTVTR
VTYADLLARVSRFANALKKRGIGKGDRVVIYIPMSIEGIVAMQACARIGATHSVVFGGFS
AKSLNERLVDVGAVALITADEQARGGKTLPLKSIADEAIAMGGCEAVKSVIVYRRTGGKI
DWHAERDLWMHDIADSEPDTCAPEWVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAAQ
TMKWTFDWKPTDVFWCTADIGWVTGHTYITYGPLACGGTQVVFEGVPTYPDAGRFWKMIG
DHKVTVFYTAPTAIRSLIKAAEADDKVHPKSHDMSSLRIIGTVGEPINPEAWMWYHKHVG
QERCPIVDTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAVVDETGQDVPNGQGGI
LVVKRPWPAMIRTIWGDPERFKKSYYPEELGGTLYLAGDGTVRDKDTGYFTIMGRIDDVL
NVSGHRLGTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEGEEAAALAK
TLRDWVGKQIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAIL
DQLAEVR
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccaaggggttgtcgatgtctgcgattgaatcggttcttcatgaaacccgccag
tttgcgccgcccgaggcgctcgagaaggcggcgaccatttccggcatgccggcctaccgt
gcgctggccgccgaggccgagcgcgattacgaaggcttctgggggcgtctcgcacgcgag
ggcctcagctggcacaagccgttcacgaaggtgctcgacgagagcgacgcgccgttctac
aagtggttcgacgacggcgaactgaacgcgtcgtacaactgcctcgaccgtcacgtcgaa
gccggcaacggcgagcgcgtcgcggtgatcttcgaggccgacgacggcaccgtcacccgc
gtcacctatgccgatctcctcgcgcgcgtgtcgcgtttcgcaaatgcgctgaagaaacgc
gggatcggcaagggcgatcgcgtcgtcatctatattccgatgtcgatcgaaggcatcgtc
gcgatgcaggcttgcgcacgcatcggcgcgacgcactcggtcgtgttcggcggcttctcc
gcgaaatcgctgaacgagcggctcgtcgacgtcggcgcggtcgcgctgatcacggccgac
gagcaggcacgcggcggcaagacgctaccgctcaagagcatcgccgacgaagcgatcgcg
atgggcggctgcgaagcggtgaagagcgtgatcgtctatcgccgcaccggcggcaagatc
gactggcatgccgagcgcgacctgtggatgcacgacatcgcggacagcgagcccgacacg
tgcgcgccggaatgggtcggcgccgagcatccgctgttcatcctgtatacgtcgggctcg
accggcaagccgaagggcgtgcagcacagcacgggcggctacctgctgtgggccgcgcag
acgatgaagtggaccttcgactggaagccaaccgacgtgttctggtgcacggccgacatc
ggctgggtcacggggcatacgtacatcacgtacggcccgctcgcatgcggcggcacgcag
gtcgtgttcgaaggcgtgccgacttacccggacgccggccgcttctggaagatgatcggc
gatcacaaggtcacggtgttctacaccgcgccgaccgcgatccgttcgctgatcaaggcc
gccgaggccgacgacaaggtccacccgaagagccatgacatgtcgagcctgcgcatcatc
ggcacggtcggcgagccgatcaatccggaagcatggatgtggtaccacaagcacgtcggc
caggagcgctgcccgatcgtcgacacgtggtggcagaccgaaaccggcggccacatgatc
acgccgctgccgggcgcgacgccgaccgtgccgggttcgtgcacgctgccgctgccgggc
atcatggccgcggtggtcgacgagacgggccaggacgtgccgaacgggcaaggcgggatt
ctcgtcgtcaagcgtccgtggccggcgatgatccgcacgatctggggcgacccggagcgc
ttcaagaagagttattacccggaagaactcggcggaacgctctacctcgccggcgacggc
acggtgcgcgacaaggacaccggctacttcacgatcatgggccgcatcgacgacgtgctg
aacgtgtcgggccaccggctcggcacgatggagatcgagtcggcactggtctcgcacgag
ctggttgcggaagcggcggtggtcggccgcccggacgacacgacgggcgaggcggtggtc
gcgttcgtggtgctgaagcgttcgcgcccggaaggcgaggaagcggcggcgctcgcgaag
acgttgcgcgactgggtcggcaagcagatcgggccgatcgcgaaaccgaaggacatccgt
ttcggcgacaacctgccgaagacgcgctcgggcaagatcatgcggcgcctgctgcgctcg
ctcgcgaagggcgaggcgatcacgcaggacacgtccacgctcgagaacccggcgatcctc
gaccagctcgcggaagtgcgctga

DBGET integrated database retrieval system