KEGG   Burkholderia cepacia GG4: GEM_1389Help
Entry
GEM_1389          CDS       T02205                                 

Definition
Malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bct  Burkholderia cepacia GG4
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GEM_1389
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GEM_1389
   00630 Glyoxylate and dicarboxylate metabolism
    GEM_1389
Enzymes [BR:bct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GEM_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1509444..1511036)
Genome map
AA seq 530 aa AA seqDB search
MSTPITLPQGMAITGEIKPGYEAILTPEALALVAALHRTFEPRRQALLQARVERTQRLDA
GERPDFLADTQAIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYQLNDKIATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLFHNAKELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEAVGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRSKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANDKAMGGVRSDKQRDATDG
YDGGWVAHPGLVPIAMEEFVKVLGDKPNQIAKQRDDVQIEGKNLLDFQPEAPITEAGLRN
NINVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLDDGRKVSAELV
REYTKAELDNVKRSVGGDTQPYERAAAIFEQMSTSEGFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgatcacgctgccgcaaggcatggcgatcaccggcgaaatcaagccgggt
tacgaagcgatcctgacgcccgaagcgctcgcactcgtcgcagcgctgcaccgcacgttc
gagccgcgccgccaggcgctgctgcaagcccgggtcgagcgcacccagcgcctcgatgcc
ggcgaacgccccgatttcctggccgacacgcaggcgatccgcgaaggcgactggaaagtc
gcgccgctgccggccgacctgcaatgccgccgtgtcgagatcaccggccccgtcgagcgc
aagatgatcatcaacgcgctgaactcgggcgccgattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggacgaaccagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgaacagaacggcaagtcgtaccagctgaacgacaagatcgcg
acgctgatcgtgcgtccgcgcggctggcacctcgacgagaagcacgtgacggtcgacggc
cagcgcgtgtccggcggcatcttcgatttcgcgctgttcctgttccacaacgcgaaggaa
ctgatcgcgcgcggctccggcccgtacttctacctgccgaagatggaaagccatctcgag
gcgcgcctgtggaacgacatcttcgtcgcggcccaggaagcggtcggcgtgccgcgcggc
acgatccgcgcgacggtgctgatcgaaacgatccttgccgcgttcgagatggacgagatc
ctgtatgaactgcgcgaacacagctcgggcctgaacgccggccgctgggactacatcttc
tcggcgatcaagaagttcaagaacgaccgcgacttctgcctggccgaccgttcgaagatc
acgatgacggtgccgttcatgcgcgcgtacgcgctgctgctgctgaagacctgccacaag
cgcaacgcgccggcgatcggcgggatgagcgcactgatcccgatcaagaacgatccggaa
gcgaacgacaaggcgatgggcggcgtgcgctcggacaagcagcgcgacgcgaccgacggc
tacgacggcggctgggtcgcgcacccgggcctcgtgccgatcgcgatggaagaattcgtc
aaggtgctcggcgacaagccgaaccagatcgcgaagcagcgcgacgacgtgcagatcgaa
ggcaagaacctgctcgacttccagcctgaagcgccgatcaccgaagccggcctgcgcaac
aacatcaacgtcggcatccactatctcggcgcctggctcgacggcaacggctgcgtgccg
atccacaacctgatggaagacgcggccacggccgagatttcccgctcgcaggtgtggcaa
tggatccgttcgccgaagggtgtgctcgacgacggccgcaaggtcagcgcggaactcgta
cgggagtacacgaaggccgagctcgacaacgtgaagcgctcggtcggcggcgacacgcag
ccatacgagcgtgccgcggcgatcttcgaacagatgtcgacgtcggaaggcttcaccgaa
ttcctgacgctgccgctgtacgaggaaatctga

DBGET integrated database retrieval system