KEGG   Burkholderia cepacia: GEM_1406Help
Entry
GEM_1406          CDS       T02205                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bct  Burkholderia cepacia
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GEM_1406
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GEM_1406
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GEM_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1528557..1529036
Genome map
AA seq 159 aa AA seqDB search
MSTLYSFSAETLAGEPASLDAYRGQVLLIVNTASECGFTPQYAGLQKLYDQYAARGFFVL
GFPCNQFGKQEPGDATQIGAFCERNYGVTFPMFAKIDVKGDHAHPLYRYLTDEAPGILGL
KAIKWNFTKFLVDRDGRIVKRYAPSTKPEEIAADIDKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccctgtattcgttcagcgcagagacgctcgccggcgagccggcgtcgctcgat
gcgtatcgcggccaggtgctgctgatcgtcaacaccgcgagcgagtgcggtttcacgccg
cagtatgcgggcctgcagaagctgtacgaccagtacgcggcgcgcggcttcttcgtgctc
ggcttcccgtgcaaccagttcggcaagcaggagccgggcgatgccacgcagatcggcgcg
ttctgcgagcgcaactacggcgtcacgttcccgatgttcgcgaagatcgacgtgaagggc
gatcacgcgcatccgctataccgctacctgaccgacgaggcgcccggcatcctcggcctc
aaggcgatcaagtggaatttcacgaaattcctggtcgaccgcgatgggcggatcgtcaag
cgctacgcgccgtcgacgaagcccgaggaaatcgcggcggatatcgacaagctgctgtaa

DBGET integrated database retrieval system