KEGG   Burkholderia cepacia: GEM_1427Help
Entry
GEM_1427          CDS       T02205                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bct  Burkholderia cepacia
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GEM_1427
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     GEM_1427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1554810..1556006
Genome map
AA seq 398 aa AA seqDB search
MQKRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFTPEVAVVGDA
TTAAHVEAQLRAAGSKTTVLYGPQALVDVSNSDGCDTVVAAIVGAAGLAPSLAAARAGKR
ILLANKESLVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDENEHGGISKIILTASG
GPFRTREPATLVDVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWIFGLPGDRID
VLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVEQLDLAQIAQLSF
EKPDYTRFPCLALALKALEEGGIASAALNAANEIAVEAFLERRIGFMAIAATVDAVLNAL
PNRSPNGLDDVLAADAEARRLAAEIIAKAPAPRVERTV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacgtctgacattgctcggttccacgggctcgatcggagacagcacgctcgac
gtggtcgcccgccatcccgagcgcttctcggtctacgcgttgaccgcgcaccgcaacggc
gacaagctcgtcgagcagtgtctgcgcttcacgcccgaagtcgcggtggtcggcgatgcg
acgacggctgcgcacgtcgaagcgcaattgcgcgcggcgggcagcaagaccacggtgctg
tacgggccgcaggcgctcgtcgacgtgtcgaacagcgacggttgcgacacggtcgtcgcg
gcgatcgtcggcgcggccggccttgcgccgagcctggcggccgcgcgtgccggcaagcgc
atcctgctcgcgaacaaggaatcgctcgtgatgtcgggcgcgatcttcatggacgccgtg
cgcgaccatggcgcgatcctgctgccggtcgacagcgaacacaacgcgatcttccagtgc
atgccgcgcgacgagaacgagcacggcgggatctcgaagatcatcctgaccgcgtcgggc
ggcccgttccgcacgcgtgagccggccacgctcgtcgacgtgacgccggacgaggcgtgc
aagcacccgaactgggtgatgggccgcaagatttccgtcgattccgcgacgatgatgaac
aagggcctcgaggtgatcgaagcccactggatcttcggtctgcctggcgaccggatcgac
gtgctgatccacccgcagagcgtgatccattcgctcgtgtcgtaccgcgacggctcggtg
ctcgcgcagctcggcaaccccgacatgcgtacgccgatcgcgcacgcgctcgcgttcccg
gaacgcgtcgacgcaggcgtcgagcagctcgacctcgcgcagatcgcgcagctgtcgttc
gagaagcccgattacacgcgcttcccgtgcctggcgctcgcgctgaaggcgcttgaggag
ggcggtatcgcgagcgctgcgttgaacgcggccaacgaaatcgcggtcgaagcgtttctc
gagcgccggatcggcttcatggcgatcgcagcgacggtcgacgccgtgctcaacgcactg
ccgaaccgcagcccgaacgggctcgacgacgtcctggcggcggatgccgaggcacgccgc
ctcgccgccgagatcattgcgaaagcgcctgcgccacgcgtggagcgcactgtctga

DBGET integrated database retrieval system