KEGG   Burkholderia cepacia GG4: GEM_1508Help
Entry
GEM_1508          CDS       T02205                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bct  Burkholderia cepacia GG4
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    GEM_1508
Enzymes [BR:bct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GEM_1508
   3.1.2  Thioester hydrolases
    3.1.2.-  
     GEM_1508
Lipid biosynthesis proteins [BR:bct01004]
 Fatty acid synthase
  Component type
   GEM_1508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1639689..1640234)
Genome map
AA seq 181 aa AA seqDB search
MLGDSLSAEYGLPRDTGWVALLRQRLATERIDYSVANASVSGDTTSGGRARLPAVLQRLK
PSIVVVELGANDALRGVPLATTEQNLRDIIADARQARAKVVLVGMYVPPNYGPDYTQKFH
AVYTRLSKELGVPLVPFLLAGIENKPEMFQSDQMHPAQQAQGILLDNVWPALKPLLGRPR
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggcgacagcctgtcagccgaatacgggctgccgcgcgacaccggctgggttgcg
ctgctgcggcaacggctcgcaaccgagcgaatcgattatagcgtcgcgaacgcgagcgtc
agcggcgacaccacgagcggcggccgcgcgcggctgcccgcggtgctgcagcggctcaag
ccgtcgatcgtcgtcgtcgagctcggcgcaaacgatgcgctgcgcggcgtgccgctcgcg
acgaccgagcagaacctgcgcgacatcatcgccgatgcgcgtcaggcacgagcgaaggtc
gtgctggtcggcatgtacgtgccgcccaactacggccccgactacacgcaaaaattccac
gcggtctatacgcggctctccaaggagctcggcgtaccactcgtgccgttcctgctggcc
gggatcgaaaacaagccggagatgttccagtccgaccagatgcatcccgcgcagcaggcg
cagggcatcctgctcgataacgtgtggccggcgctgaagccgctgctcggcaggccgcgc
ggctga

DBGET integrated database retrieval system