KEGG   Burkholderia cepacia GG4: GEM_1571Help
Entry
GEM_1571          CDS       T02205                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bct  Burkholderia cepacia GG4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GEM_1571
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GEM_1571
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GEM_1571
Enzymes [BR:bct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GEM_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1706579..1708030
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPAEYPKVSADELARWRALSYADLAFEI
LSKFCDDVPADDLRAITRRTYTAAVYSNTRHGENASDITPLKTLGTENGAALSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAKHGEALNILGATSGDTGSAAEYAMRGKAGVRVFMLSPH
QKMSAFQTAQMFSLQDPNIFNLAVEGVFDDCQDIVKAVSNDHAYKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATQSNDERVSFTVPSGNFGNVCAGHIARMMGLPIAKLVVATNENDV
LDEFFRTGAYRVRSAENTYHTSSPSMDISKASNFERFVFDLLGRDPARVMQLFRDVEEKG
GFDLAASGDFARVAEFGFVSGRSSHTDRIATIRDVFARYSTMIDTHTADGVKVAREHLDA
GVPMVVLETAQPIKFGETIREALDREAERPAAFDGLEALPQRFEVVKADAQQVKDFIAAH
TGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactacatctccacgcgcggcgccggcatcggcgagcgccatacgttctccgacatc
ctgctcggcggtctcgcgaaggacggcgggctgtacctgccggccgagtatccgaaggtt
tccgccgacgagctcgcgcgctggcgcgcgctgtcgtacgcggatctcgccttcgagatc
ctgtcgaagttctgcgacgacgtgccggccgacgacctgcgcgcgatcacgcgccgcacg
tacacggctgccgtgtacagcaacacgcgccacggcgagaacgcgtccgacatcacgccg
ctgaaaacgctcggcaccgaaaacggcgcggcgctgtcgctgctcgaactgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagctgctcggcaacctgttcgagtacacg
ctcgcgaagcacggcgaagcgctgaacatcctcggcgcgacgtcgggcgacacgggcagc
gcggccgagtacgcgatgcgcggcaaggccggcgtgcgcgtgttcatgctgtcgccgcac
cagaagatgagcgcgttccagacggcccagatgttcagcctgcaggatccgaacatcttc
aacctcgcggtcgaaggcgtgttcgacgactgccaggacatcgtgaaggccgtctcgaac
gatcacgcgtacaaggcgcagcagaagatcggcaccgtcaactcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtgtactacttcaagggctatttcgcggcgacgcagtcgaacgac
gagcgcgtgtcgttcacggtgccgtcgggcaacttcggcaacgtctgcgcgggccacatc
gcgcggatgatggggctgccgatcgcgaagctggtggtcgcgaccaacgagaacgacgtg
ctcgacgagttcttccgcaccggcgcgtatcgcgtgcgcagcgccgaaaacacgtatcac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgagcgcttcgtgttcgac
ctgctcggacgcgatccggcccgcgtgatgcagttgttccgcgacgtcgaggagaagggc
ggcttcgacctcgcggcgagcggcgatttcgcgcgcgtggccgaattcggcttcgtgtcg
ggtcgcagcagccacacggaccgcatcgcgacgatccgcgacgtgttcgcgcgctacagc
acgatgatcgatacccataccgccgacggcgtgaaggtcgcgcgcgagcatctcgacgcg
ggtgtgccgatggtggtgctcgagacggcccagccgatcaagttcggcgagacgatccgc
gaagcgctcgatcgcgaagccgagcggccggccgcattcgacgggctcgaggcgctgccg
cagcgtttcgaggtcgtgaaggccgacgcgcagcaggtgaaggacttcatcgccgcgcat
acgggcgcgtaa

DBGET integrated database retrieval system