KEGG   Burkholderia cepacia: GEM_1601Help
Entry
GEM_1601          CDS       T02205                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bct  Burkholderia cepacia
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bct00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GEM_1601
DNA repair and recombination proteins [BR:bct03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      GEM_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1737366..1737962
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRVLPGVGPKSAQRMAYHLMQHDREGAERLGRSLLFATEHLQHCEKC
NTFTEAQICEVCSDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGIVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRTM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagccgtccgccctgtccgcactcgtcgaagcgctgcgcgtattgcccggcgtc
gggccgaaatccgcgcagcgcatggcgtaccacctgatgcagcacgatcgggagggcgcg
gagcggctcggccggtcgctgctgttcgcgaccgagcacctgcagcattgcgagaagtgc
aacacgttcaccgaagcgcagatctgcgaggtctgcagcgacgaggagcgtgatccgacg
ctgctgtgcgtcgtcgagacgcctgccgaccagatcatgctcgagcagacgatgacctac
cgcgggctgtatttcgtgctgatggggcgactgagcccgcttgacggaatcggcccgaag
gaaatccatttcgaccgcctcgtgcggcgtgcgtccgacgggatcgtcaaggaggtcgtg
ctcgcgaccaacttcacgaacgagggcgaggccactgcgcattacctcggccagacgctg
aaggcgcgcgggctcgcggtcacgcgcctcgcgcgcggcgtgccggtgggcggcgagctc
gaatacgtcgatgcgggcacgatcgcccgcgcgatgctcgaccgccgcacgatgtaa

DBGET integrated database retrieval system