KEGG   Burkholderia cepacia: GEM_1604Help
Entry
GEM_1604          CDS       T02205                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bct  Burkholderia cepacia
Brite
Enzymes [BR:bct01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     GEM_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1740168..1741097
Genome map
AA seq 309 aa AA seqDB search
MSGERAKRFPLALEDLKRAPRKSEGRAGERHAASAVPKAVDKPAAVLKPVAVKPGVARAL
PGTAAAKPATAPKPTVLKPAMPKPAVPSVAPAGAFALTSERVRERMVERLRANGVTDPRV
LDAMAAVPRHMFVDPGLATQAYEDSALPIGHQQTISKPSVVARMIELAMAGRTLERVLEI
GTGCGYQATVLSHVARDVYSIERIKPLYERAKLNLRPLRVPNIRLHYGDGRVGLPSAAPF
DAIVIAAAGLDVPQALLEQLAIGGRLVAPVGAQSGQPQVLTLVERVAHAQWRESRLDRVF
FVPLKSGVI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgcgaagcggttcccgctcgcgctcgaggatctcaagcgagcgcca
cgcaaatcggagggccgggccggcgaacgccatgcggcgagcgcggtgccgaaggccgtc
gacaagcccgccgccgtgctgaagccggtggcggtgaagccgggcgtcgcccgggcgctg
cccggcacggccgccgcgaaaccggcgaccgcaccgaagccgaccgtgctgaagcccgcg
atgccgaagccggccgtgccgagcgtcgcaccggccggtgcgttcgcgcttacctcggaa
cgtgtgcgcgaacgcatggtcgaacgcctgcgcgcgaacggcgtgaccgacccgcgcgtg
ctggacgcgatggccgcggtgccacgccacatgttcgtggatccgggtctcgcgacgcag
gcctatgaggattccgcgttgccgatcggccaccagcaaacgatttcaaagccgtcggtc
gtcgcgcgcatgatcgagctcgcgatggccggccgcacgctcgagcgcgtcctcgagatc
ggcacgggttgcggctatcaggccaccgtgctgagccacgtggcgcgtgacgtgtattcg
attgaacgcatcaagccgctctatgagcgcgcgaagctgaacctgcggccgctgcgcgtg
ccgaacatccgtctgcattacggcgacgggcgtgtcggcctgccgtccgcggccccgttc
gacgcgatcgtgatcgcggcggcggggctcgacgtgccgcaggcgctgctcgagcagctc
gcgatcggcgggcggctcgtcgcgccggtcggcgcgcagagcgggcagccccaggtgctc
acgctcgtcgagcgcgttgcgcacgcgcaatggcgagagtcgcggcttgatcgcgttttc
tttgtccctttaaaatccggagtgatttga

DBGET integrated database retrieval system