KEGG   Burkholderia cepacia: GEM_1811Help
Entry
GEM_1811          CDS       T02205                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bct  Burkholderia cepacia
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GEM_1811
Enzymes [BR:bct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GEM_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1977062..1977991)
Genome map
AA seq 309 aa AA seqDB search
MTAPAAGAGRVTVVGSLNMDLVVRAPRLPLPGETLAGHAYAQAAGGKGGNQAIAAARLGA
QVAMIGCVGADAHGAALRAGLEAEGIDCARLATSATASTGVALIVVDDASQNTIVIVAGA
NGDVTTDTVARHDAALAATDVLICQLETPPDAVFAALSAGRRHGRTVVLNPAPAVAPLPD
GWLPLVDYLIPNEVEAAALTGLPVRDPADAETAARALQAAGARNVLITLGARGVLALTAD
GAARHYPAPVVPAVDTTAAGDTFIGGFAARLAAGADVDTAIRFAQRAAALSVTRAGAQPS
IPTLAELAD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcgcccgcagcgggcgccggccgcgtgacggtggtcggcagcctcaacatggat
ctcgtggtgcgcgcgccgcggctgccgctgccgggcgaaacgctcgccggccatgcgtac
gcgcaggcggcgggcggcaagggcggcaaccaggccatcgcggccgcgcggctcggcgcg
caggtcgcgatgatcggctgcgtcggcgcggatgcgcacggcgcggcgctgcgagccggc
cttgaagcggagggcatcgactgtgcgcggctcgcgacgagcgcgacggcgtcgacgggc
gtcgcgctgatcgtcgtcgacgacgcgagccagaacacgatcgtgatcgtcgcgggcgcc
aacggcgacgtcacgaccgacacggtggcacggcacgacgccgcgctggccgcgaccgac
gtgctgatctgccagctcgagacgccgccggacgccgtgttcgcggcgctgtcggccggg
cgacggcacggccgcacggtcgtgctcaatccggcgccggccgtcgcgccgctgccggac
ggctggctgccgctcgtcgattacctgatcccgaacgaagtcgaggcggccgcgctgacc
ggcctgccggtgcgtgatccagccgatgccgaaaccgccgcgcgcgcgctgcaggcggcc
ggggcgcgcaatgtgctgatcacgctcggcgcgcgcggcgtgctcgcgctgacggccgac
ggcgcggcgcgccactatccggcgccggtcgtgccggccgtcgacacgacggcggccggc
gataccttcatcggcggctttgccgcgcggcttgcggccggcgcggacgtcgacacggcg
attcgcttcgcgcaacgcgcggcggcactgtcggtgacgcgcgcaggcgcgcagccgtcg
attcccacgctcgccgaactggccgattag

DBGET integrated database retrieval system