KEGG   Burkholderia cepacia GG4: GEM_1924Help
Entry
GEM_1924          CDS       T02205                                 

Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bct  Burkholderia cepacia GG4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GEM_1924
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GEM_1924
  Amino acid metabolism
   00310 Lysine degradation
    GEM_1924
Enzymes [BR:bct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GEM_1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2085618..2086892)
Genome map
AA seq 424 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPVAATASSSAT
ASPAASKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKAAAKPSLPDV
KVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKYK
DKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVV
PILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPP
QSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARL
LLDL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcgcaggacgaaatcctgatcgaactc
gagaccgacaaggtcgtgctcgaagtgccggcaccggcagcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgttgccgaccagatcatcgcgacgatcgacaccgaa
gcgaaggcaggtgcagccgaagcagcggcaggcgccgccgaagtcaagccggcagcagcg
cctgctgcagccgcaccggcagcacagccggtcgccgcaacggcatccagctcggctacg
gcatcgccggccgcatcgaagctgctggccgagaagggcctgtcggccggtgacgtcgca
ggttcgggccgcgacggccgcgtcacgaagggcgacgcgctggccgcaggcagcgcaccg
aaggcggctccggccgccgcaccggcgaaggccgctgcgaagccgtcgctgccggacgta
aaggtgccggcgtcggccacgacctggctgaacgaccgtccggaacagcgcgtgccgatg
tcgcgcctgcgtgcgcgtatcgccgagcgtctgctcgaatcgcagcagaccaacgcgatc
ctgacgacgttcaacgaagtgaacatggctccggtcatggagctgcgcaacaagtacaag
gacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttcgtgaaggcg
gccgtgcacgcgctgaagaagttcccgctggtgaacgcgtcgatcgacggtaacgacatc
gtctatcacggctatttcgacatcggtatcgcggtcggttcgccgcgcggcctggtcgtg
ccgatcctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgccgaa
ttcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggtacgttc
tcgatctcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaacccgccg
cagtcggcgatcctcggcgtgcacgcgacgaaggagcgtccggttgtcgaaaacggccag
atcgtgatccgtccgatcaactacctggcactgtcgtacgaccaccggatcatcgacggc
cgcgaagcggtgctgtcgctcgtcgcgatgaaggacgcgctggaagatccggcacgcctg
ctgctcgacctgtaa

DBGET integrated database retrieval system