KEGG   Burkholderia cepacia GG4: GEM_1924Help
Entry
GEM_1924          CDS       T02205                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00020  Citrate cycle (TCA cycle)
bct00310  Lysine degradation
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
bct01130  Biosynthesis of antibiotics
bct01200  Carbon metabolism
Module
bct_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bct_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GEM_1924
  Amino acid metabolism
   00310 Lysine degradation
    GEM_1924
Enzymes [BR:bct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GEM_1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFQ48343
UniProt: J7JAP0
Position
1:complement(2085618..2086892)
Genome map
AA seq 424 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPVAATASSSAT
ASPAASKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKAAAKPSLPDV
KVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKYK
DKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVV
PILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPP
QSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARL
LLDL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcgcaggacgaaatcctgatcgaactc
gagaccgacaaggtcgtgctcgaagtgccggcaccggcagcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgttgccgaccagatcatcgcgacgatcgacaccgaa
gcgaaggcaggtgcagccgaagcagcggcaggcgccgccgaagtcaagccggcagcagcg
cctgctgcagccgcaccggcagcacagccggtcgccgcaacggcatccagctcggctacg
gcatcgccggccgcatcgaagctgctggccgagaagggcctgtcggccggtgacgtcgca
ggttcgggccgcgacggccgcgtcacgaagggcgacgcgctggccgcaggcagcgcaccg
aaggcggctccggccgccgcaccggcgaaggccgctgcgaagccgtcgctgccggacgta
aaggtgccggcgtcggccacgacctggctgaacgaccgtccggaacagcgcgtgccgatg
tcgcgcctgcgtgcgcgtatcgccgagcgtctgctcgaatcgcagcagaccaacgcgatc
ctgacgacgttcaacgaagtgaacatggctccggtcatggagctgcgcaacaagtacaag
gacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttcgtgaaggcg
gccgtgcacgcgctgaagaagttcccgctggtgaacgcgtcgatcgacggtaacgacatc
gtctatcacggctatttcgacatcggtatcgcggtcggttcgccgcgcggcctggtcgtg
ccgatcctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgccgaa
ttcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggtacgttc
tcgatctcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaacccgccg
cagtcggcgatcctcggcgtgcacgcgacgaaggagcgtccggttgtcgaaaacggccag
atcgtgatccgtccgatcaactacctggcactgtcgtacgaccaccggatcatcgacggc
cgcgaagcggtgctgtcgctcgtcgcgatgaaggacgcgctggaagatccggcacgcctg
ctgctcgacctgtaa

DBGET integrated database retrieval system