KEGG   Burkholderia cepacia GG4: GEM_1990Help
Entry
GEM_1990          CDS       T02205                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bct  Burkholderia cepacia GG4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GEM_1990
   00052 Galactose metabolism
    GEM_1990
   00500 Starch and sucrose metabolism
    GEM_1990
   00520 Amino sugar and nucleotide sugar metabolism
    GEM_1990
Enzymes [BR:bct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GEM_1990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2165941..2166825
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEVEAELEARGKEKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVADNPFAVILADDLLDGNPPVMKQMVDVFDHYHSSVIGVEEIPPSDTKSYGIVDGKEWE
ESIVKMSAIVEKPEPDVAPSNLGVVGRYILKPRIFEHLRALKPGAGGELQLTDAIQALLA
DEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHPEVAAEFDAYLRARGNTQPAA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggcagtattccccgtcgccggtctcggcacgcggttcctgccg
gcaacgaaggcgagcccgaaggaaatgttgccggtcgtcgacaagccgctgatccagtac
gcggtcgaggaagcgatcgccgcgggcatcaccgagatgatcttcgtgaccgggcgcagc
aagcgcgcgatcgaggaccacttcgacaagtcgtacgaagtcgaggccgaactcgaggca
cgtggcaaggagaagctgctcgaactcgtgcgcagcatcaagccgagccatgtcgactgc
ttctacgtgcgccagccggaagcgctcggcctcggccatgcggtgctgtgcgccgaaaag
ctcgtggccgacaacccgttcgcggtgatcctcgccgacgacctgctcgacggcaacccg
cccgtgatgaagcagatggtcgacgtgttcgaccactatcacagctcggtgatcggcgtg
gaagagatcccgccgtcggacacgaagtcgtacgggatcgtcgacggcaaggagtgggaa
gaatcgatcgtcaagatgtcggcgatcgtcgagaagccggaaccggacgtcgcgccgtcg
aacctcggcgtggtcggccgctacatcctgaagccgcggatcttcgaacacctgcgcgcg
ctgaagccgggcgcgggcggcgagttgcagctcaccgacgcgatccaggcgctgctcgcc
gacgagcaggtgctggcctacaagtaccagggcacgcgctacgactgcggcagcaagctc
ggctacctgaaggcgacggtcgaattcgcgctgcgccacccggaagtggccgccgagttc
gacgcgtacctgcgcgcgcgcggcaacacgcaaccggccgcctga

DBGET integrated database retrieval system