KEGG   Burkholderia cepacia GG4: GEM_2028Help
Entry
GEM_2028          CDS       T02205                                 

Definition
di-heme cytochrome c peroxidase (EC:1.11.1.7)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bct  Burkholderia cepacia GG4
Brite
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     GEM_2028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2207915..2209264)
Genome map
AA seq 449 aa AA seqDB search
MHSLLKSFASARSLIPAAATLALVGGLAALAGCDAHPGADASAVAIVPAAQAAPAAPAVA
PASQPQTRAQVFEGVKQMTALGKQLFFDPSLSGSGKLACASCHSAAHAFGPPNALSVQLG
GDDMHRTGFRAVPSLKYLRGIPPFSEHFHDSPDEGDESIDAGPTGGLTWDGRVDTRDAQA
RIPLTSPFEMSSSPARVAKAVRAAPYADAFRKAFGDRVLGDDQATFGAVLRALDAFQQQP
ALFDPYTSKYDAYLAGHAQLTPAELRGLQLFNDEKKGNCASCHVSQRTLEGGPPQFSDFG
LIAIAVPRNRALPVNRDPHFYDLGACGPERTDLKGRDEFCGLFRTPSLRNVALRKTFFHN
GVYHSLEDVMRFYVERDIHPEKFYPVVHGKVQVYDDLPKRYWPNINREPPFDRKRGEPPA
LNAAEIKDVIAFLNTLTDGYQPAATSAAR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccttctgaaatccttcgcgtccgcgcgatcgttgatccctgccgcggcgacg
ctcgcgctggtcggcggactcgcggcgctcgccggttgcgatgcgcaccccggtgccgat
gcatcggccgtcgcgatcgtgccggcggcacaggccgccccggccgctccggcagtcgcg
ccggccagccagccgcagacgcgcgcgcaggtattcgagggcgtgaagcagatgacggcg
ctcggcaagcagttgttcttcgatccgtcgctgtcggggtccggcaagctggcatgcgcg
tcgtgtcatagcgccgcgcatgcattcgggccgccgaacgcgctgtcggtacagctcggc
ggcgacgacatgcaccgcacgggttttcgcgcggtgccgtcgctgaagtacctgcgcggc
attccgccgttcagcgagcacttccacgattcaccggacgaaggtgacgaaagcatcgac
gcgggtccgaccggcgggctgacctgggatggtcgcgtcgatacgcgcgatgcacaggcg
cgcattcccctcacgtcgccattcgagatgagcagctcgccggcgcgggtcgcgaaggcg
gttcgcgccgcaccctatgccgacgcgttccgtaaggcgttcggcgatcgggtcctcggc
gacgaccaggccacgttcggcgcggtgctgcgcgcgctcgacgcattccagcagcagccg
gcgctgttcgatccgtacacgagcaagtacgacgcgtatctggccggccacgcgcagctc
acgcccgcggagttgcgcgggttgcagctgttcaacgacgagaagaagggcaactgcgcg
agctgtcacgtgagccagcgcacgctcgaaggcggcccgccgcagttcagcgatttcggc
ctgatcgcgatcgcggtgccgcgcaaccgcgcgctgccggtcaatcgcgatccgcacttt
tacgacctcggcgcgtgcggccccgagcgcaccgacctgaagggccgcgacgaattctgc
gggctgttccgcacgccgtcgctgcgcaacgtcgcgctgcgcaagacgttcttccacaac
ggcgtgtaccactcgctcgaggacgtgatgcgcttctacgtcgagcgcgacatccatccg
gagaagttttatccggtcgtgcacggcaaggtgcaggtctacgacgacctgccgaagcgc
tactggccgaacatcaaccgcgagccgccgttcgaccgcaagcgcggcgaaccgcccgcg
ctgaacgcggccgagatcaaggacgtgatcgcgttcctgaacacgctgactgacggatat
cagcccgcggcgacgtcggcggcccgctaa

DBGET integrated database retrieval system