KEGG   Burkholderia cepacia GG4: GEM_2049Help
Entry
GEM_2049          CDS       T02205                                 

Definition
(GenBank) Cellulase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
bct  Burkholderia cepacia GG4
Brite
Enzymes [BR:bct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     GEM_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(2233285..2234475)
Genome map
AA seq 396 aa AA seqDB search
MQPARRVGTTLVLAVAAACAAAGTAGRAQAAPGGAADAQCSAAWPRWDAFKRDFVSADGR
VIDVGSADSRTVSEGQAYGLFFALVANDRRTFDTVLAWTENNLAQGDLSAHLPAWLWGRA
PDGAWRVLDANAASDADLWIAYTLVEAGRLWRERSYTARGALLAKRVLDDETASVPDLGL
TLLPGPTGFKLADGRWRVNPSYSPPQVIRGLAARLPDERRWSALAASTGRVLLDTAPKGF
APDWALYRAGAGFAPDPQTHAESAYNAIRVYLWAGMLDRADPLAAPLLARFAPFADYIAA
HGAPPEKVDTTTGVAGPNDGNGGFSAAAVPFLDARGQHALADAQAARVEALARQSAPGYY
TSVLTLFGLGWRDGRYRFGADGALDARWEGRPCAAR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcagccggcgcggcgcgtcggcacgacactcgtgctggccgtcgcggcagcgtgcgcg
gcggccgggacggccgggcgtgcgcaggcggcgccaggcggcgcggccgacgcgcaatgc
agcgcggcatggccgcgctgggacgcgttcaagcgcgatttcgtgtcggctgacggccgc
gtgatcgacgtcggctcggccgattcgcgcacggtatcggaggggcaggcgtatggactg
ttcttcgcgctggtcgcgaacgaccggcgcacgttcgacacggtcctcgcatggaccgag
aacaacctcgcgcagggcgacctgagcgcgcacctgccggcatggctgtggggccgcgcg
cccgacggcgcgtggcgcgtgctcgacgcgaacgcggcgtcggatgccgacctgtggatc
gcatacacgctcgtcgaagccggcaggctgtggcgcgagcgcagctataccgcgcgcggc
gcgctgctcgcgaagcgcgtgctcgacgacgaaacggccagcgtgccggacctcggcctc
acgctgctgccggggcccaccgggttcaagctggccgatggccgatggcgcgtgaacccc
agctattcgccgccgcaggtgatccgcgggctcgccgcgcgcctgcccgacgagcgccgc
tggagcgcgctcgcggccagcaccggccgcgtgctgctcgacaccgcgccgaagggcttt
gcgccggactgggcgctgtatcgcgcaggggccggcttcgcccccgatccgcagacccat
gcggaaagcgcgtacaacgcgattcgcgtgtacctgtgggccggcatgctcgaccgtgcc
gatccgctcgccgcgccgctgctcgcgcggttcgcgccgttcgccgactatatcgccgcg
catggcgcgccgccggagaaggtcgacacgacgaccggcgtcgccgggccgaacgacggc
aacggcggcttctccgcggcggccgtgccgtttctcgacgcgcgcggccagcacgcgctc
gccgatgcgcaggcggcccgtgtcgaggcgctcgcgcgccagtcggcgcccggctactac
acgagcgtgctgacgctgttcggcctcggctggcgcgacggccgctaccggttcggcgcg
gacggggcgctcgacgcacgctgggagggccgtccgtgcgcggcccgatga

DBGET integrated database retrieval system