KEGG   Burkholderia cepacia: GEM_2209Help
Entry
GEM_2209          CDS       T02205                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bct  Burkholderia cepacia
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bct00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2411540..2412508)
Genome map
AA seq 322 aa AA seqDB search
MSQNDLAFTRDSLYGTQAEPTFAGATSFMRRRFSRDLDGVDLAITGVPFDAAASHRPGTR
FGPRGLRIASTGIAWERPWPWEFDPFDVLAAVDYGDCVFDLGQPESVPGAIERHADAILA
RGCAMLTLGGDHFITYPLLKAHAKVHGPLSLVHFDAHTDTWPDRDVKRIDHGTMFYHAAR
EGWVLPERSAQIGIRTTNDEPMGFDIQDARSVHASTPAAVAARIRERVGDHPVYLTFDID
CLDPAFAPGTGTPVSGGLSSHQALEILRHLNGINLVGMDVVEVSPPYDHAEITSLAGATI
GLELICLYASRRRQTREKSIDG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaacgatctcgcgttcacgcgcgacagcctttacggcacgcaggccgaaccg
acgttcgccggtgcgacgagtttcatgcgccggcgcttcagccgcgatctcgacggcgtc
gatctcgcgatcaccggcgtgccgttcgatgcggccgcgtcgcaccggcccggcacgcgc
ttcggcccgcgcgggctgcggatcgcgtcgaccggcatcgcgtgggagcgcccgtggccg
tgggaattcgatccgttcgacgtgctggccgcggtcgactacggcgactgcgtgttcgac
cttgggcagcccgaatcggtgccgggcgcaatcgagcggcatgcggatgcgatcctcgca
cgcggctgcgcgatgctgacgctcggcggcgatcacttcatcacgtatccgctgctgaag
gcgcatgcgaaggtgcacgggccgctgtcgctcgtgcatttcgacgcgcacaccgacacg
tggcccgatcgcgatgtcaagcgcatcgatcacggcacgatgttctatcacgcggcgcgg
gaagggtgggtcctgcccgaacggtcggcgcagatcggcatccgcacgaccaacgacgag
ccgatggggttcgacatccaggatgcgcgcagcgtgcacgcgtcgacgccggcggcggtc
gccgcgcggatccgcgagcgcgtcggcgatcatccggtgtacctcacgttcgacatcgac
tgtctcgatccggcgtttgcgccgggcaccggtacgccggtgtcgggtgggctgtcgagc
catcaggcgctcgagatcctgcgccacctgaacggcatcaacctggtcgggatggacgtg
gtcgaggtgtcgccgccgtatgatcatgcggaaatcacgtcgctggccggtgcgacgatc
gggctggaactgatctgcctgtatgcatcgcgccggcggcagacaagggaaaaatcgatc
gatggatga

DBGET integrated database retrieval system