KEGG   Burkholderia cepacia: GEM_2274Help
Entry
GEM_2274          CDS       T02205                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.6.1.15)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bct  Burkholderia cepacia
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bct03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2484910..2487201)
Genome map
AA seq 763 aa AA seqDB search
MNASDDTLEFTGGLVARLPEPADFGIALAEGFARRIGDLSRRAGAPAASARWAARAAFAT
SRATAGGHVCVSLGALAQRYEEPLDDVRAALAASGLVAFGTLARGDERPLIVDRHDHLYL
SRYFDYERRLADALVAQAGVAAPGDALSPERLRDSLARYFGPATGEVDWQRVAAIVALTG
RVTIVSGGPGTGKTTTVVGVLACLLDAQPGLRVALAAPTGKAAQRMQEALHARAGDLPPA
LAARLPDTSYTLHRLLGGGGAAGFRHHRDNPLPYDLIVVDEASMIDVALAAHLIDALAPG
ARLVLLGDKDQLAAVEAGAVFAELSARPTFTAAARTRIAAALGIDEAVFVAALPVPDGEA
VEAVAAAAPAPAPASAPVLATAARKPPARRNVDTRQASLFDDEPPDEAVASPDVAPSAAS
LQPAATGIDAGAAGADPAWIEADELAWLDAVELAPFDAHDAGAAAFASAIATRVDETTTA
PSAPAPLADCVVWLERNYRFGLDSPIGRLSLAIRRGDVQAALDALPADDAAAASFHDDAG
DTLAASTVERLARRFGAYLDALRTALSEPVPDPLPLFDALNRFRILCATRTGSRGAEHVN
ALVATHVRHAARVPLAVGAHWFTGRPIMVTRNDYALGLFNGDIGIALPDAHGVLRVWFRR
ADGTARAVSPAALPPHETAFALTVHKSQGSEFDEAALVLPASFGRVLTRELVYTAVTRAR
TRVQVIGPRRVLAQAVATRTQRDSGLAARVDEALARRRKEASR
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgtccgacgacacgctcgaattcaccggcggcctcgtggcgcgcctgcccgag
cccgcggatttcggcatcgcgctcgcggaaggtttcgcacgccgcatcggcgacctgtcg
cgccgggcgggcgcgccggccgcttccgcgcgctgggcggcgcgtgccgcgttcgcgacg
agccgcgcgacggcgggcggccacgtgtgcgtatcgctgggcgcgctcgcgcagcgctac
gaggagccgctcgacgacgtgcgcgcggcgcttgccgcgagcggcctcgtggcgttcggc
acgctcgcgcgcggcgacgaacggccgctgatcgtcgaccggcacgaccatctctatctg
tcgcgctacttcgactacgagcgccggctcgccgatgcgctcgtcgcgcaggccggcgtc
gccgcaccgggcgatgcgctgtcgcccgagcggctgcgcgacagtctcgcgcgttacttc
gggcccgcgacgggcgaagtggactggcagcgcgtcgcggcgatcgtcgcgttgacgggg
cgcgtgacgatcgtcagcggcgggcccggcaccggcaagacgacgaccgtcgtcggcgtg
ctggcttgcttgctcgacgcgcagccgggcttgcgtgtcgcgctggcggcacccaccggc
aaggccgcgcagcggatgcaggaagcgctgcatgcgcgggcgggcgacctgccgccggcg
ctcgccgcgcgcctgcccgacacgtcgtatacgttgcatcgcctgctgggcggcggcggg
gcggcggggttccgccatcatcgcgacaacccgctgccgtacgacctgatcgtggtcgac
gaggcgtcgatgatcgacgtcgcgctcgccgcgcacctgatcgatgcgctcgcgccgggc
gcgcggctcgtgctgctcggcgacaaggaccagcttgccgcggtcgaggccggcgcggtg
ttcgccgagctgagtgcgcggccgacgtttaccgccgcagcgcgcacgcgcatcgcggct
gcgctcggcatcgacgaggcggtattcgtcgcggcgttgccggtgccggacggcgaggcg
gtggaagcggttgccgccgctgctccggctccggctccggcgtccgcgccggtgttggcc
actgccgcacgcaagccgccggcacggcggaacgtggatacgcgacaggcctcgttgttc
gacgacgaaccaccggacgaagcggttgcttcgcctgacgtcgcgccatcggctgcttcg
ttgcagcctgcggcgaccggcatcgatgccggcgctgcgggtgccgatccggcatggatc
gaggccgacgagctcgcgtggctcgacgcggtcgaactggcgccgttcgatgcgcacgat
gcgggggcagcggcattcgcgtcggccatcgcaacgcgggtcgacgaaaccaccaccgcg
ccttccgcgcccgcaccgcttgcagactgcgtcgtatggctcgaacgcaattaccgtttc
ggtctcgattcgccgatcggccgcctgtcgctcgcgatccgccgcggcgacgtgcaggcc
gcgctcgacgcgttgccggcggacgatgccgctgccgcgtcgttccacgacgatgcgggc
gatacgctggcggcatcgacggtcgagcggctggcacgccggttcggcgcgtacctcgac
gcattgcgcaccgcgttgtccgagccggtgcccgatccgctgccgctgttcgatgcgctc
aaccgcttccggatcctgtgcgcgacccgcaccggttcgcgcggcgccgagcacgtgaat
gcgctggtggccacgcacgtgcgacatgccgcgcgcgtgccgctcgcggtcggtgcacac
tggttcaccgggcggccgatcatggtgacgcgcaacgactatgcgctcgggctgttcaac
ggcgacatcggcattgcgttgccggacgcgcacggcgtgctgcgcgtgtggttccggcgc
gcggacggcaccgcgcgcgcggtgtcgcctgccgcgctgccgccgcacgaaacggcgttc
gcgctgacggttcacaaatcgcagggctccgaattcgacgaggccgcgctcgtgctgccg
gcgtcgttcgggcgcgtgctcacgcgcgagctcgtctatacggcggtcacgcgcgcccgc
acgcgcgtgcaggtgatcggtccgcgacgcgtgctcgcgcaggcggtcgcgacgcgcacc
caacgcgattcggggcttgcggcgcgcgtcgacgaggcgctcgcgcggcgccgcaaggag
gcgtcgcgatga

DBGET integrated database retrieval system