KEGG   Burkholderia cepacia: GEM_2438Help
Entry
GEM_2438          CDS       T02205                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bct  Burkholderia cepacia
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bct00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bct00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2673008..2673508
Genome map
AA seq 166 aa AA seqDB search
MTTLTLIVARARNGIIGRDNQLPWKLPEDLAFFKRTTMGAPIVMGRKTHESIGRPLPGRR
NIVVTRDAARRFDGCDTVTSLADALALAARDGVAEAFLIGGAQLYAEGLVLADKLVVTEI
DADFDGDASFPAPDPAHWHEVSRDPHQAAAPNTFGYAFVVYERKRG
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgttgaccctgatcgtcgcgcgtgcccgcaacggcatcatcggccgcgacaac
cagttgccctggaaacttcccgaggacctcgcgttcttcaagcgcacgacgatgggcgcg
ccgatcgtgatgggccgcaagacccacgagtcgatcggccggccgctgccgggccgccgc
aacatcgtcgtcacccgcgacgcagcgcgccgcttcgacggctgcgacaccgtcacgtcg
ctcgccgacgcgctcgcgctcgccgcgcgcgacggggtggccgaggcattcctgatcggc
ggcgcgcagctctatgcggaaggcctcgtgctcgccgacaagctggtcgtcaccgagatc
gacgctgacttcgacggcgatgcgtcattcccggcccccgatcccgcgcactggcacgaa
gtgtcgcgcgacccgcaccaggccgccgcgccgaacacgttcggctatgcgttcgtcgtc
tacgagcgcaagcgcggctga

DBGET integrated database retrieval system