KEGG   Burkholderia cepacia GG4: GEM_2612Help
Entry
GEM_2612          CDS       T02205                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bct  Burkholderia cepacia GG4
Brite
Enzymes [BR:bct01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     GEM_2612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_31 PrmA MTS Met_10 Methyltransf_18 Methyltransf_23 Methyltransf_11 Methyltransf_12 TPMT Spermine_synth Ubie_methyltran Methyltr_RsmB-F Methyltransf_32 Glucokinase DUF938 Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: AFQ49012
UniProt: J7J474
Position
1:2844536..2845192
Genome map
AA seq 218 aa AA seqDB search
MNIENARFNMIEQQIRPWDVLDLDVLGLLSIVKRENYVSPEHRDLAFADLELPLPGSRSK
MLFPRVEARVLQELAVKKHENVLVIGAGSGYLAALFAHRAQSVTAVEIDPAIAKFAADNL
RNDGVTNAEVALGDGSLGWPGKAPYDVICVAGGLPVVPQQMLEQLKIGGRLSAFVGGRPV
MKAQIITRIDDKQYRVADVFETYVDHLVNAIEPSRFKF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaacgcgcgtttcaacatgatcgaacaacagatccggccgtgggacgtg
ctggatctggacgtcctgggcctgctgtcgatcgtcaagcgtgaaaattacgtttcgccc
gaacatcgcgatctcgcgttcgcggacctcgaactgccgctgcccggcagccgcagcaag
atgctgttcccgcgcgtcgaagcgcgcgtgctgcaggaactggcggtcaagaagcacgag
aacgtgctcgtgatcggcgcgggctccggctacctggccgcgctgttcgcgcatcgcgcg
cagtccgtgacggccgtcgagatcgatccggccatcgcgaagttcgcggcagacaacctg
cgcaacgacggcgtgacgaacgcggaagtcgcgctcggcgacggctcgctcggctggccg
ggcaaagcgccgtacgacgtgatctgcgtcgcgggcggcctgccggtcgtgccgcagcag
atgctcgaacagctgaagatcggcggccgcctgtcggcattcgtcggcggccgtccggtg
atgaaggcgcagatcatcacgcgcatcgacgacaagcagtaccgtgtcgccgacgtgttc
gaaacctacgtcgaccacctcgtcaacgcgatcgaaccgtcgcgcttcaagttctga

DBGET integrated database retrieval system