KEGG   Burkholderia cepacia: GEM_2630Help
Entry
GEM_2630          CDS       T02205                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bct  Burkholderia cepacia
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GEM_2630
   00030 Pentose phosphate pathway
    GEM_2630
   00051 Fructose and mannose metabolism
    GEM_2630
   00052 Galactose metabolism
    GEM_2630
   00500 Starch and sucrose metabolism
    GEM_2630
   00520 Amino sugar and nucleotide sugar metabolism
    GEM_2630
  Nucleotide metabolism
   00230 Purine metabolism
    GEM_2630
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GEM_2630
Enzymes [BR:bct01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GEM_2630
    5.4.2.8  phosphomannomutase
     GEM_2630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2861422..2862816)
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVVGKTLDADTARGIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGA
LADGLRAAGVDVVDVGMVPTPVGYFAASVPLPLKGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQIQALYRRIVDERFETGSGTYETFDVADQYIERIVGDVKLARPLKLVVDA
GNGVAGPLATRLFKALGCELVERFTDIDGTFPNHHPDPAHPENLQDVIQALKDTDAELGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRHLAQWVKAKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILAKTADP
SALLNGLPDAMSTPELQLWLDEGENFRLIEKLQQEAKFDGADEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVMRFEAETQEGLKRIQDDFRRVLTAAKPDVKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatatgacattcgcggcgtggtcggcaagacgctc
gacgccgacacggcgcgcgggatcggccgggcattcggcagcgaagtgcgcgcacagggc
ggtgacgccgtcgtcgtcgcgcgtgacggccgtctgtcggggcccgagctcgtcggcgca
ctcgccgatggcctgcgtgcggcgggcgtcgacgtcgtcgacgtcggcatggtgcccacg
ccggtcggctatttcgcggcgagcgtgccgctcccgctgaagggcggcgagcgtcgcgtc
gattcgtgcatcgtcgtcacgggcagccacaacccgcccgactacaacggcttcaagatg
gtgctgcgcggcgccgcgatctacggcgagcagatccaggcgctgtaccgccgtatcgtc
gacgagcgcttcgagacgggcagcggcacgtatgaaacgttcgacgtcgccgatcagtac
atcgagcgcatcgtcggcgacgtgaagctcgcgcgcccgctgaagctcgtcgtcgatgcc
ggcaacggcgtcgcaggcccgctcgcgacgcgcctgttcaaggcgctcggctgcgaactc
gtcgagcgcttcaccgacatcgacggcacgttcccgaaccaccatcccgatcccgcgcac
ccggaaaacctgcaggacgtgatccaggcgttgaaggacaccgacgccgagctcggcttc
gcgttcgacggcgacggcgaccgcctgggcgtcgtcacgaaggacggccagatcatctac
ccggaccgccagctgatgctgttcgcggaggaagtgctgtcgcgcaacccgggcgcgcag
atcatctacgacgtgaagtgcacgcgtcatctcgcgcagtgggtgaaggcgaagggcggc
gagccgctgatgtggaagacgggccattcgctcgtgaaggcgaagctgcgcgagacgggc
gcaccgctcgcgggcgagatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacggcctctacacgggtgcacgcctgctggagatcctcgcgaagacggccgacccg
agcgcgctgctgaacgggctgccggacgcgatgagcacgcccgaactgcagctctggctc
gacgagggcgagaacttccgcctgatcgagaagctgcagcaggaagcgaaattcgacggt
gcggacgaggtcgtgacgatcgacggcctgcgcgtcgagtatccggacggcttcggcctc
gcgcgttcgtcgaacacgacgccggtggtcgtgatgcggttcgaagcggagacgcaggag
gggctcaagcgcatccaggacgacttccgccgcgtgctgacggccgcgaagccggacgtc
aagctgccgttctga

DBGET integrated database retrieval system