KEGG   Burkholderia cepacia GG4: GEM_2630Help
Entry
GEM_2630          CDS       T02205                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00010  Glycolysis / Gluconeogenesis
bct00030  Pentose phosphate pathway
bct00051  Fructose and mannose metabolism
bct00052  Galactose metabolism
bct00230  Purine metabolism
bct00500  Starch and sucrose metabolism
bct00520  Amino sugar and nucleotide sugar metabolism
bct00521  Streptomycin biosynthesis
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
bct01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GEM_2630
   00030 Pentose phosphate pathway
    GEM_2630
   00051 Fructose and mannose metabolism
    GEM_2630
   00052 Galactose metabolism
    GEM_2630
   00500 Starch and sucrose metabolism
    GEM_2630
   00520 Amino sugar and nucleotide sugar metabolism
    GEM_2630
  Nucleotide metabolism
   00230 Purine metabolism
    GEM_2630
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GEM_2630
Enzymes [BR:bct01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GEM_2630
    5.4.2.8  phosphomannomutase
     GEM_2630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFQ49029
UniProt: J7J9I5
Position
1:complement(2861422..2862816)
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVVGKTLDADTARGIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGA
LADGLRAAGVDVVDVGMVPTPVGYFAASVPLPLKGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQIQALYRRIVDERFETGSGTYETFDVADQYIERIVGDVKLARPLKLVVDA
GNGVAGPLATRLFKALGCELVERFTDIDGTFPNHHPDPAHPENLQDVIQALKDTDAELGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRHLAQWVKAKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILAKTADP
SALLNGLPDAMSTPELQLWLDEGENFRLIEKLQQEAKFDGADEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVMRFEAETQEGLKRIQDDFRRVLTAAKPDVKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatatgacattcgcggcgtggtcggcaagacgctc
gacgccgacacggcgcgcgggatcggccgggcattcggcagcgaagtgcgcgcacagggc
ggtgacgccgtcgtcgtcgcgcgtgacggccgtctgtcggggcccgagctcgtcggcgca
ctcgccgatggcctgcgtgcggcgggcgtcgacgtcgtcgacgtcggcatggtgcccacg
ccggtcggctatttcgcggcgagcgtgccgctcccgctgaagggcggcgagcgtcgcgtc
gattcgtgcatcgtcgtcacgggcagccacaacccgcccgactacaacggcttcaagatg
gtgctgcgcggcgccgcgatctacggcgagcagatccaggcgctgtaccgccgtatcgtc
gacgagcgcttcgagacgggcagcggcacgtatgaaacgttcgacgtcgccgatcagtac
atcgagcgcatcgtcggcgacgtgaagctcgcgcgcccgctgaagctcgtcgtcgatgcc
ggcaacggcgtcgcaggcccgctcgcgacgcgcctgttcaaggcgctcggctgcgaactc
gtcgagcgcttcaccgacatcgacggcacgttcccgaaccaccatcccgatcccgcgcac
ccggaaaacctgcaggacgtgatccaggcgttgaaggacaccgacgccgagctcggcttc
gcgttcgacggcgacggcgaccgcctgggcgtcgtcacgaaggacggccagatcatctac
ccggaccgccagctgatgctgttcgcggaggaagtgctgtcgcgcaacccgggcgcgcag
atcatctacgacgtgaagtgcacgcgtcatctcgcgcagtgggtgaaggcgaagggcggc
gagccgctgatgtggaagacgggccattcgctcgtgaaggcgaagctgcgcgagacgggc
gcaccgctcgcgggcgagatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacggcctctacacgggtgcacgcctgctggagatcctcgcgaagacggccgacccg
agcgcgctgctgaacgggctgccggacgcgatgagcacgcccgaactgcagctctggctc
gacgagggcgagaacttccgcctgatcgagaagctgcagcaggaagcgaaattcgacggt
gcggacgaggtcgtgacgatcgacggcctgcgcgtcgagtatccggacggcttcggcctc
gcgcgttcgtcgaacacgacgccggtggtcgtgatgcggttcgaagcggagacgcaggag
gggctcaagcgcatccaggacgacttccgccgcgtgctgacggccgcgaagccggacgtc
aagctgccgttctga

DBGET integrated database retrieval system