KEGG   Burkholderia cepacia: GEM_2768Help
Entry
GEM_2768          CDS       T02205                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bct  Burkholderia cepacia
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GEM_2768
Enzymes [BR:bct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     GEM_2768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3026634..3027176
Genome map
AA seq 180 aa AA seqDB search
MTVAYIGLGANLGDARQTLKDAVVCLAQQRTISILGKSSLYRTAPFEAGGDDYYNCVVKL
DTTLSARELLALCQKIEHHFGRERPYRNAPRTLDLDILLFGTDSIDEPDLIVPHPRLTDR
AFALVPLVEIEPALDIPARGRAAAFLAAVANQRVEKVQACQCLMQKALAASADADKNRCR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcatatatcggactgggggcgaatctcggcgatgcgcgccagaccctgaag
gacgcggtggtgtgtcttgcgcagcagcgcaccatctcgatcctcggcaaatcgagcctg
tatcgcacggcgcccttcgaagcgggcggcgacgattactacaactgcgtcgtcaagctc
gacacgacgctgtcggcccgtgagctgctcgcgctctgccagaagatcgaacatcacttc
gggcgcgagcgcccgtatcgcaacgcgccgcgcacgctcgacctcgacatcctgctgttc
ggcaccgactcgatcgacgaaccggacctgatcgtcccgcacccgcgcctcaccgatcgc
gcattcgcgctcgtgccgctcgtcgagatcgagccggcgctcgacatccccgcgcgcggc
cgcgccgccgcgttcctcgcggcggttgccaaccagcgcgtcgagaaggtgcaggcctgt
caatgtctgatgcagaaggccctggccgccagcgcagacgccgacaagaaccgctgccga
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system