KEGG   Burkholderia cepacia: GEM_2834Help
Entry
GEM_2834          CDS       T02205                                 

Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bct  Burkholderia cepacia
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bct00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GEM_2834
Enzymes [BR:bct01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GEM_2834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3104689..3105270
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGILLEKNPPHLLVDCNGVGYEIDVPMSTFYNLPQTGERVVLLTQQIVREDAHLL
YGFLTPQERTTFRELLKITGIGARMALAVLSGMSVQELAQAVTMQDAARLTRLPGIGKKT
AERLLLELKGKLGADLGALAGAASPSDHATDILNALLALGYSEKEGLAAIKNVPAGTGVS
EGIKLALKALSKV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcatcgccggcatcctgctcgaaaagaacccgcctcacctgctcgtcgac
tgcaacggcgtcggctacgaaatcgacgtgccgatgagcaccttctacaacctgccgcaa
accggcgagcgcgtcgtgctgctcacgcagcagatcgtgcgcgaggacgcgcacctgctg
tacggcttcctgacgccgcaggagcgcacgaccttccgcgaactgctgaagatcaccggc
atcggcgcgcgcatggcgcttgccgtgctgtccggcatgagcgtgcaggagctcgcgcag
gccgtgacgatgcaggacgccgcgcgcctcacgcgcctgcccggtatcggcaagaagacc
gccgagcgcctgctgctcgaattgaagggcaagctcggcgcggacctcggcgcgctcgcc
ggcgccgcgtcgccgtccgatcacgcgaccgacatcctcaacgcgttgctcgcgctcggc
tactccgaaaaggaaggcctcgccgcgatcaagaacgtgccggccggcaccggcgtgtcc
gaaggcatcaagctcgcgctcaaggcattgtcgaaggtgtaa

DBGET integrated database retrieval system