KEGG   Burkholderia cepacia GG4: GEM_2935Help
Entry
GEM_2935          CDS       T02205                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00330  Arginine and proline metabolism
bct00332  Carbapenem biosynthesis
bct01100  Metabolic pathways
bct01130  Biosynthesis of antibiotics
bct01230  Biosynthesis of amino acids
Module
bct_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GEM_2935
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    GEM_2935
Enzymes [BR:bct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GEM_2935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFQ49333
UniProt: J7JDH2
Position
1:complement(3211438..3212556)
Genome map
AA seq 372 aa AA seqDB search
MRSIIADSKRLVVKVGSSLVTNDGKGLDHAAIGRWAAQIAALRAQGKEVVLVSSGAIAEG
MQRLGWSKRPREIDELQAAAAVGQMGLAQVYESRFTEHDIRTAQILLTHADLADRERYLN
ARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEGDALIILTDQSGLFT
ADPRKDPNATLVAEASAGAPELEAMAGGAGSSLGRGGMLTKILAAKRAAHSGANTVIASG
RESDVLVRLAAGEAIGTQLIARTARMAARKQWMADHLQVRGHVVIDAGAVEKLTSGGKSL
LPIGVTGVQGAFARGEVIACVGPDGREVARGLTNYSSAETKLIHRKPSGEIETVLGYMLE
PELIHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgatcatcgcggattcgaagcgattggtggtgaaggtgggttccagcctcgtg
accaacgatggcaaggggctcgatcatgctgcaatcggccgctgggctgcccagatcgcc
gcgctgcgcgcgcagggcaaggaagtcgtgctcgtcagctcgggcgcgattgccgaaggg
atgcagcggctcggttggagcaagcgtccgcgcgagatcgacgagttgcaggctgccgcc
gcggtcggccagatggggctcgcgcaagtctacgaaagccgcttcaccgagcacgatatc
cgcaccgcgcagatcctgctcacgcacgccgacctggccgatcgcgaacgctacctgaat
gcgcgttcgacgctgctcacgctgctgcggctcggcgtcgtgccgatcatcaacgagaac
gacaccgtcgtcaccgatgaaatcaagttcggcgacaacgacacgctcggtgcgctcgtc
gcgaacctgatcgaaggcgatgcgctgatcatcctgaccgatcagtcggggctgttcacc
gccgatccgcgcaaggacccgaacgcgacgctggtcgcggaggccagcgcgggtgcgccg
gaactcgaggcaatggcgggcggcgctggctcgagcctcggccgcggcgggatgctgacg
aagatcctcgcggcgaaacgcgcggcgcatagcggcgcgaacaccgtgatcgcgagcggt
cgggaatccgacgtgctggtgcggctggcggcaggcgaggcgatcggcacgcagctgatc
gcgcgcactgcgcggatggcggcgcgcaagcagtggatggccgatcacttgcaggtgcgc
gggcacgtcgtgatcgatgcgggcgcggtcgagaagctgacgtccggcggcaagagcctg
ctgccgatcggcgtgaccggtgtgcagggtgcgttcgcgcgcggcgaggtgatcgcgtgt
gtcggccccgacgggcgtgaagtggcgcgcggcctcacgaactacagcagcgcggaaacg
aagctgattcaccgcaagccgagcggcgagatcgagacggtgctcggctacatgctcgag
ccggaactgattcaccgcgacaacctcgtgctggtgtaa

DBGET integrated database retrieval system