KEGG   Burkholderia cepacia GG4: GEM_2982Help
Entry
GEM_2982          CDS       T02205                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00071  Fatty acid degradation
bct00072  Synthesis and degradation of ketone bodies
bct00280  Valine, leucine and isoleucine degradation
bct00310  Lysine degradation
bct00362  Benzoate degradation
bct00380  Tryptophan metabolism
bct00620  Pyruvate metabolism
bct00630  Glyoxylate and dicarboxylate metabolism
bct00640  Propanoate metabolism
bct00650  Butanoate metabolism
bct00900  Terpenoid backbone biosynthesis
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
bct01130  Biosynthesis of antibiotics
bct01200  Carbon metabolism
bct01212  Fatty acid metabolism
bct02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GEM_2982
   00630 Glyoxylate and dicarboxylate metabolism
    GEM_2982
   00640 Propanoate metabolism
    GEM_2982
   00650 Butanoate metabolism
    GEM_2982
  Lipid metabolism
   00071 Fatty acid degradation
    GEM_2982
   00072 Synthesis and degradation of ketone bodies
    GEM_2982
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GEM_2982
   00310 Lysine degradation
    GEM_2982
   00380 Tryptophan metabolism
    GEM_2982
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GEM_2982
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GEM_2982
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GEM_2982
Enzymes [BR:bct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GEM_2982
Exosome [BR:bct04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GEM_2982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFQ49378
UniProt: J7JDL3
Position
1:3261698..3262918
Genome map
AA seq 406 aa AA seqDB search
MHIDTPMTDAYICDAIRTPIGRYGGALKDVRADDLGAVPLKALIERNRDVDWSAIDDVIY
GCANQAGEDNRNVARMSALLAGLPTAVPGTTLNRLCGSGMDAVGTAARAIKAGEARLMIA
GGVESMTRAPFVMGKAASAFARQADIFDTTIGWRFVNPLMKQLHGVDSMPETAENVAVDY
NISRADQDLFALRSQQKAARAQQDGTLAAEIVPVTIAQKKGDALVVSRDEHPRETSLEAL
AKLKGVVRPDGSVTAGNASGVNDGACALLLANAEAADEYRLRRRARVIGMATAGVEPRVM
GIGPAPAAQKLLRQLGMSIDQFDVIELNEAFASQGLAVLRMLGVADDDPRVNPNGGAIAL
GHPLGASGARLVTTALHQLERTGGRFALCTMCIGVGQGIALAIERV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgcacatcgatacgcccatgacagacgcctacatctgcgacgcgattcgcacccccatc
ggccgctacggcggcgccctgaaagacgttcgagccgacgatctcggtgcggtgccgctc
aaggcgctgatcgaacgcaaccgcgacgtcgactggtcggcgatcgatgacgtgatctac
ggctgcgcgaaccaggccggcgaggacaaccgcaacgtcgcgcgcatgtccgcgctgctg
gcgggcctgccgaccgccgtgccgggcacgacgctgaaccggctgtgcggctcgggcatg
gacgcggtcggcacggccgcacgcgcgatcaaggcaggcgaggcacgtttgatgatcgcg
ggcggcgtcgaaagcatgacgcgcgcgcccttcgtgatgggcaaggccgccagcgcattc
gcccgtcaggccgacattttcgacacgacgatcggctggcgcttcgtcaatccgctgatg
aaacagctgcatggcgtcgattcgatgccggagacggccgagaacgtcgcagtcgactac
aacatcagccgtgccgaccaggatctgttcgcgctgcgcagccagcagaaggccgcgcgt
gcgcagcaggacggcacgcttgccgcggaaatcgtcccggtcacgattgcgcagaagaaa
ggcgacgcgctggtcgtgtcgcgcgacgagcatccgcgcgagacctcgctcgaagcgctt
gcgaagctgaagggtgtcgtgcgcccggacggctcggtgacggccggcaacgcgtcgggc
gtcaacgacggtgcatgcgcgctgctcctcgccaacgcggaagccgccgatgaatatcgg
ctgcgccgccgcgcacgcgtcatcggcatggcgactgccggcgtcgaaccgcgcgtgatg
ggcatcggcccggcgccggccgcgcagaagctgctgcgccagctcggcatgtcgatcgac
cagttcgacgtgatcgagctgaacgaagcgttcgcgtcgcagggtcttgcggtgctgcgc
atgctcggcgtcgcagacgacgatccgcgcgtgaacccgaacggcggtgcgatcgcgctg
ggccacccgctcggtgcatcgggcgcccggctcgtgaccaccgcgcttcaccaactcgag
cgtacgggcggccgttttgcgctttgtacgatgtgcatcggcgtcggccaaggcatcgca
ctcgccatcgaacgcgtgtag

DBGET integrated database retrieval system