KEGG   Burkholderia cepacia: GEM_2994Help
Entry
GEM_2994          CDS       T02205                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bct  Burkholderia cepacia
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GEM_2994
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GEM_2994
Enzymes [BR:bct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GEM_2994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3272531..3273316
Genome map
AA seq 261 aa AA seqDB search
MSDILDRIIAVKREEIAAAMRSTPLEALKLEASARDLRDFVGALRAKQAAGNAAVIAEVK
KASPSKGVLREHFVPADIARSYAAHGAACLSVLTDEQFFQGSVRYLEEARAACTLPVLRK
DFIVDAYQILEARAMGADAILLIAAALDTPLMQDLEAYAHSLGLAVLVEVHDRNEMEQAL
TLKTPLLGINNRNLRTFETTIQTTLDMLDMIPPDRMVVTESGILSRTDVDTMRAANVNAF
LVGEAFMRADQPGEELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattctcgaccgaatcatcgccgtcaagcgtgaagaaatcgcggcggccatg
cgcagcacgccgctcgaggcactgaaactggaagcgtccgcgcgtgacctgcgcgacttc
gtcggcgcgctgcgcgcgaagcaagcggccggcaacgcggcggtgatcgccgaagtgaag
aaggccagcccgtcgaagggcgtgctgcgcgagcatttcgtgccggccgacatcgcgcgc
tcgtatgcagcccacggtgccgcgtgcctgtcggtgctgaccgacgagcagttcttccag
ggcagcgtccgctatctcgaggaagcacgcgcggcctgcacgctgccggtgctgcgcaag
gacttcatcgtcgatgcataccagatcctcgaagcgcgcgcgatgggcgccgacgcgatc
ctgctgatcgcggccgcgctcgacacgccgctgatgcaggacctcgaggcgtatgcgcac
tcgctcggcctcgcggtgctggtcgaagtgcacgaccgcaacgagatggaacaggcgctg
acgctgaagacgccgctgctcggcatcaacaaccgcaacctgcgcacgttcgagacgacg
atccagaccacgctcgacatgctcgacatgattccgccggaccgcatggtcgtgaccgag
tcgggcatcctgtcgcgcaccgacgtcgacacgatgcgcgcggcgaacgtgaacgcgttc
ctcgtcggcgaggcgttcatgcgcgccgaccagccgggcgaggaactcgcgcggatgttc
ttctga

DBGET integrated database retrieval system