KEGG   Burkholderia cepacia: GEM_2999Help
Entry
GEM_2999          CDS       T02205                                 

Definition
protein-disulfide isomerase-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bct  Burkholderia cepacia
Brite
Enzymes [BR:bct01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     GEM_2999
Secretion system [BR:bct02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   GEM_2999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3277638..3278366)
Genome map
AA seq 242 aa AA seqDB search
MKKTIRIASLALAVTMATLGCTAQADQTTDKLKATLQTRLGSDAPIKSVSKSPVEGLYEV
NLGSQIIYSDAAGDYVLLGDLVDTKTHKNLTDARLSDLNKIDFASLPLANAIKVVKGNGA
RKIAVFSDPNCPYCKRLETTLQSIDNVTVYTFLYPVLSPDSTAKSKVIWCATDRAKSWEG
WMLDHRVPSGAGNCDTTALDKNLALGRGMNVTGTPTIFLPDGRRLPGAVSADQLNQALAS
SK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgatccgcatcgcatcgctggcgctggccgtcacgatggcgacgctcggc
tgcaccgcgcaggccgaccaaaccaccgacaagctgaaagccacgctgcaaacgcgtctc
ggcagcgacgcgccgatcaagagcgtatcgaaatcgccggtcgagggcctgtacgaagtg
aacctcggctcgcagatcatctatagcgatgcagccggcgactacgtgctgctcggcgat
ctcgtcgataccaagacgcacaagaacctgaccgacgcgcgcctgtccgacctcaacaag
atcgacttcgcgagcctgccgctcgcgaacgcgatcaaggtcgtcaagggcaacggcgcg
cgcaagatcgcggtgttctccgatccgaattgcccgtactgcaagcgactcgagacgacg
ctgcagtcgatcgacaacgtgaccgtctacacgttcctgtacccggtgctgtcgcccgat
tcgaccgcgaagtcgaaggtgatctggtgcgcgaccgaccgtgcgaaatcctgggagggc
tggatgctcgaccatcgcgtaccgtccggcgccggcaattgcgatacgaccgcactcgac
aagaacctcgcgctcggccgcgggatgaacgtcacgggcacgccgacgatcttcctgccc
gacggccgtcgcctgccgggcgcggtgtcggccgaccagctgaaccaggcgctcgcgtcg
agcaagtaa

DBGET integrated database retrieval system