KEGG   Burkholderia cepacia: GEM_3097Help
Entry
GEM_3097          CDS       T02205                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bct  Burkholderia cepacia
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bct01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bct00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3374875..3376191)
Genome map
AA seq 438 aa AA seqDB search
MAITIRKLDSTSEGFDAALRAVLAFEASEDDAIEQSVAQILADVKSRGDAAVLEYTNRFD
RLDASSVAALELPQDALQTALDGLAPKARAALEAAAARVRAYHEKQKIECGTHSWQYTES
DGTVLGQKITPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVGEIVMVVPTPDGVKNELV
LAAALLGGVDRVFTIGGAQAVGALAYGTATVPPVDKICGPGNAYVASAKRRVFGTVGIDM
IAGPSEILVLCDGTTDPNWVAMDLFSQAEHDELAQSILLCPDGAFLERVEKAIDELLPTM
PRQDVIRASLEGRGALIKVRDMAEACRIANDIAPEHLEISALEPQQWGQQIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFIKRSSLIEVSAEGAQTLGEIASELA
YGEGLQAHARSAELRMKG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggccatcaccatccgcaaactcgattcgacgagcgaaggcttcgacgccgcgctgcgt
gcggtgctcgcattcgaggcgagcgaggacgacgcgatcgagcaatcggtcgcgcagatt
ctcgccgacgtgaagtcgcgcggcgacgccgcggtgctcgagtacacgaaccgcttcgac
cggctggacgcgagcagcgtcgccgcgctcgaactgccgcaggacgcgctgcagacggcg
ctcgacggcctcgcgccgaaggcgcgtgcggcgctggaagccgcggccgcacgcgtgcgt
gcgtaccacgagaagcagaagatcgagtgcggcacgcatagctggcagtacacggaaagc
gacggcacggtgctcggccagaagatcacgccgctcgaccgcgtcggcctgtacgtgccg
ggcggcaaggccgcctatccgtcgtcggtgctgatgaacgcgattcccgcgcgcgtcgcg
ggtgtcggcgagatcgtgatggtcgtgccgaccccggacggcgtgaagaacgagctcgtg
ctcgccgcggcgctgctcggtggcgtcgatcgcgtgttcacgatcggcggcgcgcaggcg
gtcggcgcgctcgcgtacggcacggccacggtgccgccggtcgacaagatctgcgggccg
ggcaatgcgtacgtcgcctcggcgaagcgccgcgtgttcggcacggtcggcatcgacatg
atcgccgggccgtcggaaatcctcgtgctgtgtgacggcacgaccgatccgaactgggtc
gcgatggacctgttctcgcaggccgaacacgacgagctcgcgcagtcgatcctgctgtgc
ccggacggcgcattcctcgagcgcgtcgagaaggcgatcgacgagctgctgccgacgatg
ccgcgccaggacgtgatccgtgcgtcgctcgaaggccgcggcgcgctgatcaaggtgcgc
gacatggccgaagcgtgccgcatcgcgaacgacatcgcacccgagcacctcgagatttcc
gcgctggagccgcagcaatggggccagcagatccgccacgcgggcgcgatcttcctcggc
cgctacacgagcgaaagcctcggcgactactgcgcgggcccgaaccacgtgctgccgacg
tcgcgcaccgcgcgcttctcgtcgccgctcggcgtgtacgatttcatcaagcgctcgagc
ctgatcgaagtcagcgccgaaggcgcgcagacgctcggcgagatcgcctccgagctcgcg
tacggcgaagggctgcaggcgcacgcgcggagcgccgaactgcggatgaaggggtga

DBGET integrated database retrieval system