KEGG   Burkholderia cepacia GG4: GEM_3196Help
Entry
GEM_3196          CDS       T02205                                 

Definition
(GenBank) agmatinase
  KO
K12255  guanidinobutyrase [EC:3.5.3.7]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00330  Arginine and proline metabolism
bct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GEM_3196
Enzymes [BR:bct01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     GEM_3196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase 2-Hacid_dh UPF0489 B12-binding_2
Motif
Other DBs
NCBI-ProteinID: AFQ49589
UniProt: J7JB57
Position
2:complement(10176..11132)
Genome map
AA seq 318 aa AA seqDB search
MNEHTHFQPLGGNEMPRSGGIATMMRLPHVASAAGLDACFVGVPFDLGTSNRTGARFGPR
QIRTESVLLRPYNMATRAAPFDSLQIADIGDVAINPYNLHDSIARIEAAYDAILEHDCKP
ITLGGDHTIALPILRAIHRKHGKVALIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLH
GDKVTQIGLRGTGYAAEDFDWCREQGFRVVQAEECWNKSLAPLMDEVRARVGDTPVYISF
DIDGIDPAYAPGTGTPEIAGLTVPQALEIIRGAKGLNIVGCDLVEVAPPYDPFGTTALLG
ANLAYELLCVLPGVAYRD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacacacccatttccagccgctcggcggcaatgaaatgccgcgcagcggcggc
atcgcgacgatgatgcgcctgccgcacgtggcgagtgccgcagggctcgacgcgtgtttc
gtcggcgtgccgttcgacctcggcacctccaaccgcaccggcgcgcgcttcggcccgcgc
cagatccgcaccgaatccgtgctgctgcgcccgtacaacatggccacgcgcgcggccccc
ttcgattcgctgcagatcgccgacatcggcgacgtcgcgatcaatccctacaacctgcac
gattccatcgcgcgcatcgaagccgcgtacgacgcgattctcgagcacgactgcaagccg
atcacgctcggcggcgaccatacgatcgcgctcccgatcctgcgcgcgatccaccgtaag
cacggcaaggttgcattgatccacgtcgatgcacacgccgacgtgaacgatacgatgatg
ggcgaaaagatcgcgcacggcacgccgtttcgccgcgcggtcgaggaagggctgctgcac
ggcgacaaggtcacgcagatcggcctgcgcggcacgggctacgccgccgaggatttcgac
tggtgccgcgagcagggcttccgcgtggtgcaggccgaggaatgctggaacaagtcgctc
gcgccgctgatggacgaagtgcgcgcgcgcgtcggcgacacgcccgtctacatcagcttc
gacatcgacggcatcgacccggcctacgcgcccggcaccggcacgccggaaatcgcgggt
ctcacggtgccgcaggcgctcgagatcatccgcggcgcgaaggggctgaacatcgtcggc
tgcgatctcgtcgaagtcgcgccgccgtacgacccgttcggcaccacagcgctgctcggc
gcgaacctcgcctacgagttgctgtgcgtattgccgggcgtcgcgtaccgcgactga

DBGET integrated database retrieval system