KEGG   Burkholderia cepacia: GEM_3196Help
Entry
GEM_3196          CDS       T02205                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bct  Burkholderia cepacia
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GEM_3196
Enzymes [BR:bct01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     GEM_3196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(10176..11132)
Genome map
AA seq 318 aa AA seqDB search
MNEHTHFQPLGGNEMPRSGGIATMMRLPHVASAAGLDACFVGVPFDLGTSNRTGARFGPR
QIRTESVLLRPYNMATRAAPFDSLQIADIGDVAINPYNLHDSIARIEAAYDAILEHDCKP
ITLGGDHTIALPILRAIHRKHGKVALIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLH
GDKVTQIGLRGTGYAAEDFDWCREQGFRVVQAEECWNKSLAPLMDEVRARVGDTPVYISF
DIDGIDPAYAPGTGTPEIAGLTVPQALEIIRGAKGLNIVGCDLVEVAPPYDPFGTTALLG
ANLAYELLCVLPGVAYRD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacacacccatttccagccgctcggcggcaatgaaatgccgcgcagcggcggc
atcgcgacgatgatgcgcctgccgcacgtggcgagtgccgcagggctcgacgcgtgtttc
gtcggcgtgccgttcgacctcggcacctccaaccgcaccggcgcgcgcttcggcccgcgc
cagatccgcaccgaatccgtgctgctgcgcccgtacaacatggccacgcgcgcggccccc
ttcgattcgctgcagatcgccgacatcggcgacgtcgcgatcaatccctacaacctgcac
gattccatcgcgcgcatcgaagccgcgtacgacgcgattctcgagcacgactgcaagccg
atcacgctcggcggcgaccatacgatcgcgctcccgatcctgcgcgcgatccaccgtaag
cacggcaaggttgcattgatccacgtcgatgcacacgccgacgtgaacgatacgatgatg
ggcgaaaagatcgcgcacggcacgccgtttcgccgcgcggtcgaggaagggctgctgcac
ggcgacaaggtcacgcagatcggcctgcgcggcacgggctacgccgccgaggatttcgac
tggtgccgcgagcagggcttccgcgtggtgcaggccgaggaatgctggaacaagtcgctc
gcgccgctgatggacgaagtgcgcgcgcgcgtcggcgacacgcccgtctacatcagcttc
gacatcgacggcatcgacccggcctacgcgcccggcaccggcacgccggaaatcgcgggt
ctcacggtgccgcaggcgctcgagatcatccgcggcgcgaaggggctgaacatcgtcggc
tgcgatctcgtcgaagtcgcgccgccgtacgacccgttcggcaccacagcgctgctcggc
gcgaacctcgcctacgagttgctgtgcgtattgccgggcgtcgcgtaccgcgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system