KEGG   Burkholderia cepacia: GEM_3352Help
Entry
GEM_3352          CDS       T02205                                 

Definition
alcohol dehydrogenase GroES-like protein (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bct  Burkholderia cepacia
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bct01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:bct00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bct00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:187589..188785
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYLGPGQVEVQKIDYPKMVDPTGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVVEVGRDVETLKIGDLVSVPFNVACGRCAMCKDTHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMAKIRDLTCLSDILPTGYHGAV
SAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNAERLAHARAMGFETVDLSKD
ASLGEQIEQILGVPEIDCAVDCVGFEAHGHGSSGHSEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAKDKAAQHGSLSIRFGLGWAKSHSFFTGQTPVLKYNRNLMQAILFDRLPIA
KIVNVEVISLDQAPEGYKKFDGGAPRKFVIDPHGLLAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgaggtgtcgtctatcttgggccgggccaggtcgaagtccagaagatc
gattatccgaagatggtcgatccgaccggccgcgcgatcggccacggcgtgatcctgaaa
gtggtcagcacgaacatctgcggttccgaccagcacatggtgcgcggccgcacgactgcc
cccgtcggcctcgtgctcggtcacgagatcacgggcgaagtggtcgaagtgggccgcgac
gtcgagacgctgaagatcggcgatctcgtgtcggtgccgttcaacgtcgcgtgcggtcgt
tgcgcgatgtgcaaggacacccatacgggcgtgtgcctgaacgtgaacccgtcgcgtgcc
ggcggcgcatacggctacgtcgacatgggcggctggatcggcggccaggccgagtacgtg
ctcgtgccgtacgccgacttcaacctgctgaaattcccggaccgcgaccaggcgatggcg
aagatccgcgacctgacctgcctgtccgacattctgccgaccgggtatcacggcgcggtg
agcgcgggcgtgaagccgggctcgacggtctacatcgcgggcgcgggcccggtcgggatg
gccgcggccgcatcggcgcgcctgctcggcgcggcggtgacgatcgtcggcgacatgaac
gcggaacgcctcgcacacgcgcgggcgatgggcttcgagacggtcgacctgtcgaaggac
gcgtcgctcggcgagcagatcgagcagatcctcggcgtgccggagatcgactgcgcggtc
gactgcgtcggcttcgaggcgcacggccacggatcgtcgggccattccgaggaagcgccc
gcgacggtgctgaactcgctgatggaaatcacgcggccggccggcgcgatcggcatcccg
ggcctgtacgtgacggacgatccgggcgcgaaggacaaggccgcgcagcacggcagcctg
agcattcgcttcggcctcggctgggcgaagtcgcattcgttcttcacgggtcagacgccg
gtgctgaagtacaaccgcaacctgatgcaggcgatcctgttcgaccgtctgccgatcgcg
aagatcgtcaacgtcgaggtgatctcgctcgaccaggcgccggaaggctacaagaagttc
gacggcggcgcgccgcgcaaattcgtgatcgatccgcacggtttgctggcagcctga

DBGET integrated database retrieval system