KEGG   Burkholderia cepacia GG4: GEM_3352Help
Entry
GEM_3352          CDS       T02205                                 

Definition
(GenBank) alcohol dehydrogenase GroES-like protein
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00625  Chloroalkane and chloroalkene degradation
bct00680  Methane metabolism
bct01100  Metabolic pathways
bct01120  Microbial metabolism in diverse environments
bct01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    GEM_3352
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GEM_3352
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     GEM_3352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_3 XdhC_C 2-Hacid_dh_C Glutaredoxin HI0933_like
Motif
Other DBs
NCBI-ProteinID: AFQ49745
UniProt: J7J6U8
Position
2:187589..188785
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYLGPGQVEVQKIDYPKMVDPTGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVVEVGRDVETLKIGDLVSVPFNVACGRCAMCKDTHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMAKIRDLTCLSDILPTGYHGAV
SAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNAERLAHARAMGFETVDLSKD
ASLGEQIEQILGVPEIDCAVDCVGFEAHGHGSSGHSEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAKDKAAQHGSLSIRFGLGWAKSHSFFTGQTPVLKYNRNLMQAILFDRLPIA
KIVNVEVISLDQAPEGYKKFDGGAPRKFVIDPHGLLAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgaggtgtcgtctatcttgggccgggccaggtcgaagtccagaagatc
gattatccgaagatggtcgatccgaccggccgcgcgatcggccacggcgtgatcctgaaa
gtggtcagcacgaacatctgcggttccgaccagcacatggtgcgcggccgcacgactgcc
cccgtcggcctcgtgctcggtcacgagatcacgggcgaagtggtcgaagtgggccgcgac
gtcgagacgctgaagatcggcgatctcgtgtcggtgccgttcaacgtcgcgtgcggtcgt
tgcgcgatgtgcaaggacacccatacgggcgtgtgcctgaacgtgaacccgtcgcgtgcc
ggcggcgcatacggctacgtcgacatgggcggctggatcggcggccaggccgagtacgtg
ctcgtgccgtacgccgacttcaacctgctgaaattcccggaccgcgaccaggcgatggcg
aagatccgcgacctgacctgcctgtccgacattctgccgaccgggtatcacggcgcggtg
agcgcgggcgtgaagccgggctcgacggtctacatcgcgggcgcgggcccggtcgggatg
gccgcggccgcatcggcgcgcctgctcggcgcggcggtgacgatcgtcggcgacatgaac
gcggaacgcctcgcacacgcgcgggcgatgggcttcgagacggtcgacctgtcgaaggac
gcgtcgctcggcgagcagatcgagcagatcctcggcgtgccggagatcgactgcgcggtc
gactgcgtcggcttcgaggcgcacggccacggatcgtcgggccattccgaggaagcgccc
gcgacggtgctgaactcgctgatggaaatcacgcggccggccggcgcgatcggcatcccg
ggcctgtacgtgacggacgatccgggcgcgaaggacaaggccgcgcagcacggcagcctg
agcattcgcttcggcctcggctgggcgaagtcgcattcgttcttcacgggtcagacgccg
gtgctgaagtacaaccgcaacctgatgcaggcgatcctgttcgaccgtctgccgatcgcg
aagatcgtcaacgtcgaggtgatctcgctcgaccaggcgccggaaggctacaagaagttc
gacggcggcgcgccgcgcaaattcgtgatcgatccgcacggtttgctggcagcctga

DBGET integrated database retrieval system