KEGG   Burkholderia cepacia: GEM_3654Help
Entry
GEM_3654          CDS       T02205                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bct  Burkholderia cepacia
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bct00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bct00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(514421..515716)
Genome map
AA seq 431 aa AA seqDB search
MTVPQQAFLRDAMRRLNMTREAFASRIGVSRRALDTWLLPDDSQESRGMPEIVERFVSEI
VERSAPEGGEYTQSVDKQGLSRQFLFEGKPQLISVDQFSRDSVEALFRVADVMQPIARRH
KISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRV
MAGYVDALVIRHPEKGSVAEFARATNLPVINGGDGPGEHPSQALLDLYTIQREFSRLGKI
VDGAHIALVGDLKYGRTVHSLVKLLALYRGLKFTLVSPPTLEMPAYIIDQIATNGHVIEQ
TNDLAAGLRGADVVYATRIQKERFTDESFEGYTPDFQINQALVDSVCKPDTLIMHPLPRD
SRPGANDLSVDLNRDPRLAIFRQTDNGIPVRMAIFAVLLGVENLVQHSMRDATWRPPAYL
GPEDAVFHGID
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttccccagcaagccttcctgcgcgacgcgatgcgccgcctcaacatgacccgc
gaagcgttcgcgagccgcatcggcgtgagccgccgtgcgctggatacctggctgttgccc
gacgattcgcaggaatcgcgcgggatgccggagatcgtcgagcgcttcgtgtcggaaatc
gtcgagcgctcggcgccggaaggcggggaatatacgcaaagcgtagacaaacaaggcctt
tccaggcaattcctgttcgaaggcaagccgcagctgatttccgtcgaccagttctcgcgg
gactcggtcgaggcactgttccgcgtcgccgacgtgatgcagccgatcgcgcgccgccac
aagatctcgcgcgtgctcgaaggcgcggtgctcggcaacctgttcttcgaagccagcacg
cgcacgcgcgtgtcgttcggcgcggccttctgccggctcggcggctcggtgtgcgacacc
accggcttcacgttctcgtcgatggccaagggcgaatcgatctacgacacgagccgcgtg
atggccggctatgtcgacgcgctcgtgatccgccacccggaaaagggctcggttgccgaa
ttcgcgcgcgcgaccaacctgccggtgatcaacggcggcgacggcccgggcgagcatccg
agccaggcgctgctcgatctctatacgatccagcgcgaattctcgcggctcggcaagatc
gtcgacggcgcgcacatcgcgctcgtcggcgacctgaaatacggccgcacggtgcactcg
ctcgtcaagctgctcgcgttgtaccgcgggctcaagttcacactcgtgtcgccgccgacg
ctcgaaatgccggcctacatcatcgaccagatcgcgacgaacggccatgtgatcgagcag
acgaacgaccttgcggccgggctgcgcggcgcggacgtcgtctatgcgacgcggattcag
aaggagcgcttcaccgacgagtcgttcgagggctatacgccggatttccagatcaaccag
gcgctcgtcgattccgtctgcaagcccgacacgctgatcatgcacccgctgccgcgcgac
agccggcccggcgcgaacgacctgtcggtcgacctgaaccgcgatccgcgtctcgcgatc
ttccggcagaccgacaacggcattccggtgcggatggcgatcttcgcggtactgctcggc
gtcgagaacctcgtccagcattcgatgcgcgacgcgacgtggcgtccgccggcatacctc
gggccggaggatgcggtgtttcacgggatcgattga

DBGET integrated database retrieval system