KEGG   Burkholderia cepacia GG4: GEM_3804Help
Entry
GEM_3804          CDS       T02205                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bct  Burkholderia cepacia GG4
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GEM_3804
Enzymes [BR:bct01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     GEM_3804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:668986..669948
Genome map
AA seq 320 aa AA seqDB search
MTELLHGDGAIRRTTPYGSSIENTYAGVLSFMRRNYSRALDGVDVAISGVPLDLATTYRS
GARLGPAAIRAASVQLAELNPYPWGFDPFDDLAAIDYGDCWFDAHNPLSIRPAIVEHART
ILRSGAKMLTLGGDHYITYPLLVAHAERYGKPLSLIHFDAHCDTWADDEPDSLNHGTMFY
KAVKEGLIDPATSVQVGIRTWNDDFLGIERLDAAWVHEHGPRAAVERIVDIVGARPAYLT
FDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRALGAVNLVGADVVEVAPAYDHADITAIA
AAHVACDLLCLWRQKKVAGR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactgctccacggcgacggcgcgatccgtcgcacgacgccatacggctcctcg
atcgaaaacacctatgcgggcgtactgtcgttcatgcgccgcaactattcgcgcgcgctc
gacggcgtcgacgtcgcgatttccggcgtgccgctcgacctcgcgacgacctatcgctcg
ggcgcgcggctcgggccggccgcgatccgcgcggcgagcgtgcagctcgcggagctcaat
ccgtatccgtggggcttcgatccgttcgacgatctcgcggcgatcgattacggcgactgc
tggttcgatgcgcacaacccgctgtcgatcaggccggcgatcgtcgagcatgcacgcacg
atcctgcgctccggcgcgaagatgctgacgctcggcggcgatcactacatcacgtatccg
ctactggtcgcgcacgcggagcgctacggcaagccgttgtcgctgatccacttcgacgcg
cactgcgatacgtgggccgacgacgagccggacagcctcaatcacggcacgatgttctac
aaggcggtcaaggaagggctgatcgatccggcgacatcggtgcaggtcggcatccgcacg
tggaacgacgatttcctcgggatcgagcggctcgatgccgcgtgggtgcatgagcatggt
ccgcgcgcggcggtggagcggatcgtcgacatcgtcggcgcgcggcccgcatacctgacg
ttcgatatcgactgtctcgatccggcgttcgcgcccggtacggggacgccggtcgcgggc
gggttgtcgtccgcgcaggcgctcgcgatcgtgcgtgcgctcggcgcggtgaatctggtc
ggtgcggatgtcgtcgaggtcgcgccggcttacgatcacgcggatatcacggcgattgcc
gctgcgcatgttgcgtgtgatttgctgtgtctgtggcggcagaagaaggtggcggggcgt
tga

DBGET integrated database retrieval system