KEGG   Burkholderia cepacia GG4: GEM_4139Help
Entry
GEM_4139          CDS       T02205                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00630  Glyoxylate and dicarboxylate metabolism
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
bct01200  Carbon metabolism
Module
bct_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GEM_4139
Enzymes [BR:bct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GEM_4139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFQ50529
UniProt: J7JDT2
Position
2:1037393..1038976
Genome map
AA seq 527 aa AA seqDB search
MSQYQDDIKAVAGLKENHGSAWNAISPEYAARMRAQNKFKTGLDIAKYTAKIMRADMAAY
DADPAKYTQSLGCWHGFIGQQKMISIKKHFNSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRELDTAKDAAAKAAIQEKIDNHVTHVVPIIA
DIDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAI
RYAFLELGVDDGIIVARTDSLGAGLTKQIAVTNAPGDLGDQYNAFLDCEELSADQLGNGD
VIIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCITSLQNGADLLWIETEKPHIAQIGG
MVSEIRKVIPNAKLVYNNSPSFNWTLNFRQQAFDTMKAAGKDVSAYDRAQLMSVEYDETE
LAKLADEKIRTFQADASREAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVAGVQ
RKEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKAAGKDNTMNQF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaatatcaagacgacatcaaggcagtggctggcttgaaggaaaaccacggcagc
gcgtggaatgccatcagccccgagtatgccgcccgcatgcgtgcccagaacaagttcaag
acgggcctcgacatcgcgaagtacaccgcgaagatcatgcgcgccgacatggccgcgtac
gatgccgacccggccaagtacacgcagtcgctgggttgctggcacggcttcatcggccag
cagaagatgatctccatcaagaagcacttcaacagcaccgagcgccgctacctgtacctg
tcgggctggatggtcgccgcgctgcgctcggagttcggcccgctgccggaccagtcgatg
cacgaaaagacctcggtcagcgcgctgatccgcgagctgtacacgttcctgcgccaggcc
gacgcccgtgaactcggcggcctgttccgcgagctcgatacggccaaggacgccgctgcg
aaggctgcgatccaggaaaagatcgacaaccacgtcacgcacgtcgtgccgatcatcgcc
gacatcgacgccggtttcggcaacgccgaagcaacctacctgctggccaagcagttcatc
gaggcaggcgcctgctgcatccagatcgagaaccaggtgtccgacgagaagcagtgcggc
caccaggacggcaaggtcaccgtgccgcacgaggacttcctcgcgaagatccgcgcgatc
cgctacgcgttcctggagctgggcgtggacgacggcatcatcgtcgcccgtaccgactcg
ctcggcgccggcctgaccaagcagatcgccgtgaccaacgcgccgggcgacctgggcgac
caatacaatgcgttcctcgactgcgaagagctgtcggccgaccagctgggcaacggcgac
gtcatcatcaagcgcgacggcaagctgctgcgtccgaagcgcctgccgagcaacctgttc
cagttccgcgccggcacgggcgaagcacgttgcgtgctcgattgcatcacgtcgctgcag
aacggcgccgacttgctgtggatcgaaaccgaaaagccgcacatcgcgcagatcggcggc
atggtcagcgaaatccgcaaggtcatcccgaacgcgaagctggtgtacaacaacagcccg
tcgttcaactggacgctgaacttccgtcagcaggcgtttgacacgatgaaggccgcgggc
aaggacgtgtcggcatacgaccgtgcgcagctgatgagcgtcgagtacgacgagaccgaa
ctcgccaagctcgccgacgagaagatccgcacgttccaggccgatgcgtcgcgtgaagca
ggcatcttccaccacctgatcacgctgccgacgtaccacacggccgccctgtcgaccgac
aacctcgcgaaggaatacttcggcgaccagggcatgctcggttacgtggccggcgtgcag
cgcaaggaaatccgtcagggcatcgcgtgcgtcaagcaccagaacatgtccggctcggat
atcggcgacgaccacaaggaatacttcagcggcgaagcagcactgaaggcggcgggcaag
gacaacacgatgaaccagttctga

DBGET integrated database retrieval system