KEGG   Burkholderia cepacia: GEM_4238Help
Entry
GEM_4238          CDS       T02205                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bct  Burkholderia cepacia
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bct00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bct00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1169066..1170367
Genome map
AA seq 433 aa AA seqDB search
MSNLIVHGGTPLRGDIKPSANKNAVLPILCATLLTDQPLRLVGVPDITDVRKILDIFRTL
GSDVSVDFATGILELHHRNTKFDPAVHRLPEAMRSSIMLIPPLLARFGVARLENDVKGCT
LGVREIDPHVEVFERFGAHIQRTPDSLIVRADGPLTANDHWLDYASVTTTENFALCATVA
SGTSTLMNAASEPHVQEFCQFLAMIGVAIEGIGTSRLCVTGGARLGGGEFRFAEDFHEIA
TFLALGAITGGDITVRNSSPEHFPLIDRTFAKFGVTVTHRDGWSRAERDGPLRVRRPFTQ
NILTKVEAAPWPYLPVDLLPIFIALGVRAEGSAMFWNKVYDGALGWSGELSKFGAHVLLS
DPHRLITFGGLQLTPARVESPYIIRVAIALLMVAASIEGRSEIMNALPIRRAHPHFVENL
RSVGANVEWTTGE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatctcatcgtccacggcggcaccccgctgcgcggggacatcaagccgtccgcg
aacaagaacgccgtcctgccgatcctgtgcgccaccctgttgaccgatcagccgctgcgc
ctcgtcggcgtgccggacatcaccgacgtgcgcaagatcctcgacatcttccgcacgctc
ggcagcgacgtgtcggtcgacttcgcaacgggcattctcgaactccaccatcgcaacacg
aaattcgatcctgccgtccaccggctgcccgaagcgatgcgctcgtcgatcatgctgatt
ccgccgctgctcgcacgcttcggtgtcgcgcgcctcgagaacgacgtgaagggctgcacg
ctgggcgtgcgcgaaatcgatccgcacgtcgaagtgttcgagcgcttcggcgcgcacatc
cagcgcacgccggattcgctgatcgtccgtgccgatggcccgctgacggccaacgatcac
tggctcgactacgcgtcggtgacgaccaccgagaacttcgcgctgtgcgcgacggtagcg
agcggcacgtccacgctgatgaacgcggcatccgagccgcacgtgcaggagttctgccag
ttcctcgcgatgatcggcgtcgcgatcgagggcatcggcacgtcgcgcctctgcgtgacc
ggcggcgcgcgcctcggcggcggcgaattccgcttcgccgaggatttccatgaaatcgcg
acgttccttgcgctgggcgcgatcacgggcggcgacatcacggtgcgcaattcgtcgccg
gagcatttcccgctgatcgaccgcacgttcgcgaagttcggcgtgaccgtcacgcaccgc
gacggctggtcccgcgcggaacgcgatggcccgctgcgcgtgcgccggccgttcacgcag
aacatcctgaccaaggtcgaagccgcaccgtggccgtacctgccggtcgacctgctgccg
atcttcatcgcgctcggcgtgcgcgcggaaggcagcgcgatgttctggaacaaggtctac
gacggcgcgctcggctggtccggcgagctgtcgaaattcggcgcgcacgtgctgctgtcc
gatccgcaccggttgatcacgttcggcgggctgcaactgacaccggcacgcgtcgaaagc
ccgtacatcatccgcgtcgcgatcgcgctgctgatggtggccgcgagcatcgaaggccgc
tcggaaatcatgaacgcgctgccgatccgccgcgcgcatccgcatttcgtcgaaaacctg
cgttcggtcggcgcgaacgtcgagtggacgaccggcgagtaa

DBGET integrated database retrieval system