KEGG   Burkholderia cepacia: GEM_4287Help
Entry
GEM_4287          CDS       T02205                                 

Definition
di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bct  Burkholderia cepacia
Brite
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     GEM_4287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1217957..1219375
Genome map
AA seq 472 aa AA seqDB search
MTARPAYPSPDASGAAAPRSPARVLRRAAYVFGTAVLGYGAFAIAFPARTPAAIGDVVAD
WTGANPHPVVLQRPAAQPLSAVAQLGRALFADPSLSASGKQSCASCHSPDHAYGPPNGLD
VQPGGLAMTQQGYRPPPSLMYLYRQPNFSIGPDAGENDAAPSVAQQAASAAGVVKAQKVA
GTSAAPQLVPQGGMFWDGRADTLQQQAFGPLLNPVEMANASIDDVAHKLAQSSHRARFEQ
LFGARVFDSPQLAVSEAMFAIARYQVEDPSFHPYNSKYDRWLEGRARLTQAELHGLRLFN
DPDKANCAGCHLSKPGKDGLPPMFTDFQYEALGAPRNQALAQNRNPAFYDLGVCGPFRDD
LKDQTQYCAMFLTPTLRNSATRHVFFHNGVFHTLDQVMAFYNERSISPQKFYSRGADGKV
DEYDDVPPKYRANVDVTDAPFDRKPGDKPAMTAQDIEDIEAFLGTLTDEPTR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacagcccgtcccgcgtacccgtctcccgacgcatccggcgccgccgcgccgcgttcc
cctgcccgcgtgctgcgccgcgcggcgtacgtgttcggcaccgccgtgctcggctacggc
gcgttcgcgatcgcgtttccggcgcgcacgccggcagcaatcggcgacgtcgttgccgac
tggaccggcgcgaatccgcatccggtcgtgctgcagcgcccggccgcgcagccgctgtcc
gcggtcgcacagctcgggcgggcgctgttcgccgatccgtcgctgtcggcatccggcaag
cagtcgtgcgcgtcgtgtcacagccccgatcatgcgtacgggccgccgaacgggctcgac
gtgcagccgggtggcctcgcgatgacgcagcagggctaccgcccgccgccgtcgctgatg
tacctgtaccggcaaccgaacttcagcatcggccccgatgcgggcgaaaacgacgccgcg
ccgagcgtcgcgcagcaggccgcgtcggcggccggtgtcgtcaaggcgcagaaggtggcc
ggcacgtcggctgcgccgcagctcgtgccgcagggcgggatgttctgggacggccgcgcc
gatacgctgcagcagcaggcgttcgggccgctgctgaaccccgtagaaatggcgaatgcg
agcatcgacgacgtcgcgcacaagctcgcgcagtcgtcgcatcgcgcgcgcttcgagcag
ctgttcggcgcgcgcgtgttcgacagtccgcagctcgcggtgtcggaagcgatgttcgcg
atcgcgcggtatcaggtcgaggacccgtcgttccatccgtacaacagcaagtacgaccgc
tggctcgagggccgcgcacgcctcacgcaggcggagctgcacgggctgcggctcttcaac
gatccggacaaggcgaattgcgccggctgccacctgtcgaagcccggcaaggacggcctg
ccgccgatgtttaccgacttccagtacgaggcgctcggcgcaccgcgcaaccaggcgctc
gcgcagaaccgcaacccggcgttctacgatctcggcgtgtgcggcccgttccgcgacgac
ctgaaggaccagacgcagtattgcgcgatgttcctgacgcccacgctgcgtaactcggcg
acgcgtcatgtgttcttccacaacggcgtgttccatacgctcgaccaggtgatggcgttc
tacaacgagcgcagcatctcgccgcagaagttctattcgcgcggcgcggacggcaaggtc
gacgagtacgacgacgttccgccgaagtaccgcgcgaacgtcgacgtgaccgatgcgccg
ttcgaccgcaagcccggcgacaagcccgcgatgaccgcgcaggacatcgaggatatcgaa
gcgtttctcggcacgctcaccgacgagccgacacgctga

DBGET integrated database retrieval system