KEGG   Burkholderia cepacia GG4: GEM_4495Help
Entry
GEM_4495          CDS       T02205                                 

Definition
2,3-dimethylmalate lyase (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bct  Burkholderia cepacia GG4
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    GEM_4495
Enzymes [BR:bct01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     GEM_4495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1451315..1453000
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNVR
GAGVDRLKAMLATLQARPDFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGAGNGSAR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcgcgcagcgcacgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaacggcctgtccgcgcggatcgtc
cgcgaagccggcttcaaggggatctgggcctcgggcctcgcgatctccgcgcagttcggc
gtacgcgacaacaacgaagcgagctggacccaggtcgtcgacgtgctcgagttcatggcc
gacgcaagcgacctgcccatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgaacagcgcggcatcgccggcgtctgtatcgaggac
aagcagttcccgaagaccaacagcttcatcggcggcgagcgccagccgctcgcggaaatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagaccgatcccgacttctcg
atcgtcgcgcgtgtcgaagcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtacgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtaatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcatcggcatccgcgatgcaggcgaccgcgcgcgag
atccacgagagcgaaacgctgatcaacgtcgaggaccgcgttgcatcggtcaacgagatc
ttccgcctgcaggacgccgacgagtactcggccgccgagcgtatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgccgcgatcgtgctcgccgcgagccgcggcaagggcctcgaagcc
gtgaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagacgcacggcgtgaacgacatcaccgtggttggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctcgtggtcaacgaacgtcatgcgcagacg
ggcgaactcgcgtcgctcgcatgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcgtgcgcgacctcgcggagagcgaggccgag
ttcagcgtggtggtcgattcgtcgctgacggaaaccaaccagagcgtacgcgatttcgcg
ctgtgctcggcggcggacgatcgcggcctgttcggccagaaaacctacctgcaacgcgtg
tcgagcgacgtcgccgcgggcacgccgcacggccgctggatcggcctgctgaacgtgcgc
ggtgcaggcgtcgaccgcctgaaggccatgcttgcgacgctgcaggcgcgccccgatttc
gacacgctcgacatcccgtcgctgctcaacgaactgatcgccgccggcgagaagatcgag
gtgcagtacgtgcacggccactggcgcggcgtcaacgacctggaagacttccgccgcgca
ggcgacttcgcgcacggccagacgccgctgtccgagccgggcgccggcaacgggagcgca
cgatga

DBGET integrated database retrieval system