KEGG   Burkholderia cepacia: GEM_4581Help
Entry
GEM_4581          CDS       T02205                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bct  Burkholderia cepacia
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bct00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GEM_4581
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GEM_4581
Enzymes [BR:bct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GEM_4581
Two-component system [BR:bct02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   GEM_4581
Bacterial motility proteins [BR:bct02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GEM_4581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1552328..1553332
Genome map
AA seq 334 aa AA seqDB search
MNIGIVNDLPLAVEAMRRAIARRPEHRVLWVATDGAQAVELCAAQPPDVVLMDLIMPKFD
GIEATRRIMRSGRPCAILIVTSCIGANAWRVFEAMGAGALDAVDTPRLGEGAAGDTARLL
LAKIDQIGRLLDAPGGVRAPGTPVRTGGGPLIAIGASAGGPGALASILGSLPADFTAPIV
IVQHVDRAFAEGMAQWLDGQTSLTVRVAREGDRPQPGVALLAATDDHLRITRAGTLEYTR
EPAATPYRPSVDVFFNSLTEHWPGRVIGVLLTGMGRDGAIGLKALRMKGYHTIAQDEATS
AVYGMPKAAATLGAARAILPLERIAGELAALARI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcggcatcgtcaacgacctcccgcttgccgtggaggcgatgcggcgcgcgatc
gcgcgccggcccgagcatcgcgtgctgtgggtcgcgaccgacggcgcgcaggccgtcgaa
ctgtgcgccgcgcagcctcccgacgtcgtgctgatggacctgatcatgccgaagttcgac
gggatcgaggcgacgcggcggatcatgcgctccggccgcccgtgcgcgatcctgatcgtg
acgagctgcatcggcgcgaacgcgtggcgcgtgttcgaagcgatgggcgccggcgcgctc
gacgcggtcgacacgccgcgcctcggcgaaggcgcggccggcgacaccgcgcgcctgctg
ctcgcgaagatcgaccagatcggccgcctgctcgacgcgcccggcggcgtccgcgcgccc
ggcacgcccgtccgcaccggcggcgggccgctgatcgcgatcggcgcgtccgccggcggc
cccggcgcgctcgcgtcgattctcggcagcctgccggccgacttcactgcgccgatcgtg
atcgtgcagcacgtcgaccgcgcgttcgccgaaggaatggcccaatggctcgacggccag
acctcgctgaccgtacgcgtcgcgcgcgaaggcgaccgcccgcagccgggcgtcgcgctg
cttgccgcgaccgacgatcacctgcgcatcacgcgcgccggcacgctcgaatacacccgc
gagccggccgccacgccgtaccggccgtcggtcgacgtgttcttcaacagcctgaccgag
cactggccgggccgcgtgatcggcgtgctgctgacgggcatgggtcgcgacggcgcgatc
ggcctgaaggcgctgcggatgaagggctaccatacgatcgcgcaagacgaggcgacgagc
gccgtctacgggatgccgaaagcggccgcgacgctcggcgccgcacgcgcgatcctgccg
ctcgagcgcatcgcgggcgagctggcggcactcgcgcggatctga

DBGET integrated database retrieval system