KEGG   Burkholderia cepacia: GEM_4669Help
Entry
GEM_4669          CDS       T02205                                 

Definition
Enoyl-CoA hydratase/isomerase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bct  Burkholderia cepacia
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    GEM_4669
  Lipid metabolism
   00071 Fatty acid degradation
    GEM_4669
Enzymes [BR:bct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GEM_4669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1645393..1646166
Genome map
AA seq 257 aa AA seqDB search
MDFRFERIESGAVFTITRPDRLNALDRAVWDGLESCLDAVERDGTRFLLITAEGERAFSA
GSDLKDNAIETWDQQARKNDRIRNLLLRLSRSPLFTIAAMNGAAFGGGLELALACTVRTA
VKRATFAMPEIRLGVMPTYGGTQFLPAVVGRSRAAELMLTGRVLNAQEAQMWGLVSFVKD
DRAALLDHAIALGNEVAGFSAVAYRSILDSLPSTDGPADQAGMDREAALMRRVLETDDAK
EGIAAFLEKRRPVFKGQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttggatttccgatttgagcgcatcgagtccggcgccgtcttcacgatcacccgtcccgat
cgattgaatgcactcgatcgcgcagtctgggacggactcgagtcttgcctggacgcggtg
gaacgggatggcacgcgatttctgctgatcacggccgaaggagaacgtgcgttcagcgcc
ggtagcgatctgaaagacaacgccatcgagacctgggaccagcaagccaggaagaacgac
cgcattcgcaatctgctgctgcgactttcacgatcgccgctgttcacgatcgcggcgatg
aacggcgccgcgtttggcgggggactggaactcgcgctcgcgtgcacagtgcggaccgcg
gtgaaacgtgccacattcgcgatgccggaaatccggttgggcgtgatgccgacatacggc
ggaactcaattcctgccggccgtcgtcggtcgttcacgcgcggcggaattgatgctgacc
ggacgagtgctgaatgctcaggaagcccagatgtggggactcgtgagcttcgtgaaagat
gaccgcgctgccctgctggaccacgcgatcgcgttaggtaacgaggtggcggggttcagc
gccgtcgcgtatcggagcatcctcgacagccttccctcgaccgacggccctgccgaccaa
gccgggatggacagggaagccgcactgatgcggcgtgtgctcgaaaccgacgacgcgaaa
gaaggtattgctgctttcctggagaaacgcagaccggtcttcaaaggccaatga

DBGET integrated database retrieval system