KEGG   Burkholderia cepacia GG4: GEM_4669Help
Entry
GEM_4669          CDS       T02205                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
Organism
bct  Burkholderia cepacia GG4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:1645393..1646166
Genome map
AA seq 257 aa AA seqDB search
MDFRFERIESGAVFTITRPDRLNALDRAVWDGLESCLDAVERDGTRFLLITAEGERAFSA
GSDLKDNAIETWDQQARKNDRIRNLLLRLSRSPLFTIAAMNGAAFGGGLELALACTVRTA
VKRATFAMPEIRLGVMPTYGGTQFLPAVVGRSRAAELMLTGRVLNAQEAQMWGLVSFVKD
DRAALLDHAIALGNEVAGFSAVAYRSILDSLPSTDGPADQAGMDREAALMRRVLETDDAK
EGIAAFLEKRRPVFKGQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttggatttccgatttgagcgcatcgagtccggcgccgtcttcacgatcacccgtcccgat
cgattgaatgcactcgatcgcgcagtctgggacggactcgagtcttgcctggacgcggtg
gaacgggatggcacgcgatttctgctgatcacggccgaaggagaacgtgcgttcagcgcc
ggtagcgatctgaaagacaacgccatcgagacctgggaccagcaagccaggaagaacgac
cgcattcgcaatctgctgctgcgactttcacgatcgccgctgttcacgatcgcggcgatg
aacggcgccgcgtttggcgggggactggaactcgcgctcgcgtgcacagtgcggaccgcg
gtgaaacgtgccacattcgcgatgccggaaatccggttgggcgtgatgccgacatacggc
ggaactcaattcctgccggccgtcgtcggtcgttcacgcgcggcggaattgatgctgacc
ggacgagtgctgaatgctcaggaagcccagatgtggggactcgtgagcttcgtgaaagat
gaccgcgctgccctgctggaccacgcgatcgcgttaggtaacgaggtggcggggttcagc
gccgtcgcgtatcggagcatcctcgacagccttccctcgaccgacggccctgccgaccaa
gccgggatggacagggaagccgcactgatgcggcgtgtgctcgaaaccgacgacgcgaaa
gaaggtattgctgctttcctggagaaacgcagaccggtcttcaaaggccaatga

DBGET integrated database retrieval system