KEGG   Burkholderia cepacia GG4: GEM_4690Help
Entry
GEM_4690          CDS       T02205                                 

Definition
(GenBank) NAD-binding 3-hydroxyacyl-CoA dehydrogenase protein
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00071  Fatty acid degradation
bct00280  Valine, leucine and isoleucine degradation
bct00281  Geraniol degradation
bct00310  Lysine degradation
bct00362  Benzoate degradation
bct00380  Tryptophan metabolism
bct00410  beta-Alanine metabolism
bct00640  Propanoate metabolism
bct00650  Butanoate metabolism
bct00903  Limonene and pinene degradation
bct00930  Caprolactam degradation
bct01040  Biosynthesis of unsaturated fatty acids
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
bct01130  Biosynthesis of antibiotics
bct01200  Carbon metabolism
bct01212  Fatty acid metabolism
Module
bct_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GEM_4690
   00650 Butanoate metabolism
    GEM_4690
  Lipid metabolism
   00071 Fatty acid degradation
    GEM_4690
   01040 Biosynthesis of unsaturated fatty acids
    GEM_4690
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GEM_4690
   00310 Lysine degradation
    GEM_4690
   00380 Tryptophan metabolism
    GEM_4690
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GEM_4690
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GEM_4690
   00281 Geraniol degradation
    GEM_4690
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GEM_4690
   00930 Caprolactam degradation
    GEM_4690
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     GEM_4690
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GEM_4690
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     GEM_4690
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     GEM_4690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 BRO1
Motif
Other DBs
NCBI-ProteinID: AFQ51080
UniProt: J7JAT3
Position
2:complement(1670435..1672600)
Genome map
AA seq 721 aa AA seqDB search
MFQGQSLRVSPLGDNGIFELCFDRQGESINKFDRRTIDELRQANQYLLNQAGLRGVLVTS
AKNVFIVGADITEFGVKFAQPAAAIAADVAGSNDAFIQFEDLPVPSVVAINGFALGGGLE
FALTGAMRVMSSDAQIGVPEVKLGLFPGFGGTVRLVRIAGPAVACDWVAAGKPATPAAAF
AAGVVDDIASPDELRSRALHLLERAIANEVDWQALQDRKRKPLSAEVAAQAAAAFEQGRA
IAAERGSPHQPAALAAIDMMAEGAALDRAGALALEARVFGEIARTQAASSMVQTFLSEQA
VKKIARHREKGAGKVSGALVLGAGIMGGGIAITHALRKIPARMYDLQQRALDQGMAEARK
QVARHVKTGRLSESASVEILSAVRPQLNLAGIGDADAVVEAIVENLDVKRKVLADLEPSL
KEEAILVSNTSSLRIDDIAAPLKRPERFVGMHFFNPVPMMPLVEVVRGTRTSDQAVATAV
AYATALGKTAIVVRDCPGFLVNRVLTAYIRGFLKLIADGADFEQVDKVMESFGWPMGPAY
LEDVVGMDTGSHVNNVISAGYADRMPELADDALRVMVRHGRFGQKNGLGFYRYEASATGG
KPRRTSSTDAHALLAQLQSEGRRNFTDEEIVDRMMLPMVLEAARTLHEGVVATAAEVDLA
MQLGLGFPAYAGGPLKYADWLGLAEVVHRCDALSALGPAYEPGQRLREMASANDRFYPIT
Q
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcaagggcaaagcttgcgcgtctcgccgctaggcgataacggcattttcgaattg
tgcttcgatcgtcagggcgaatccatcaacaaattcgaccgcaggacgatcgacgaattg
cggcaggccaaccagtacctgctgaatcaggccggcctgcgaggcgtcctggtgacgagc
gcgaagaacgttttcatcgtcggagcggatatcaccgaattcggggtcaagttcgcgcag
ccggcggcggccattgccgcggacgtcgcgggaagcaacgacgccttcatccagttcgaa
gacctgccggttccttccgtggtggcgatcaacggcttcgcgttgggtggaggcctcgaa
tttgcgctgactggcgcaatgcgcgtcatgtcgagcgacgcgcagatcggtgtgccggaa
gtgaagctggggctgttccccggattcgggggcacggtccggctggtgcgcattgcgggg
cccgcggtggcgtgcgactgggttgccgccggcaaacctgccacgcctgcggccgccttc
gctgccggcgtggttgacgatatcgcgtcaccggacgaactgcggtcccgtgcgctccat
ttgctcgagcgggcgatcgcaaacgaagtcgattggcaggcgctgcaggatcgaaaacgc
aagccgctgtcagcggaagtggccgcacaagccgcggctgctttcgagcaaggtcgcgcc
atcgcagccgaacgtggctcgccgcaccagcctgccgcgctcgccgcaatcgacatgatg
gccgagggggcggccctcgaccgtgccggtgcgctggctctcgaagcgagagtgttcggc
gaaatcgcccgtacccaggccgcgtcgtcgatggttcagacctttctgagcgaacaggct
gtcaagaagatcgcgcgccaccgcgaaaaaggggctggcaaggtgtccggcgcgttggtg
ctgggcgcggggatcatgggcggcgggatagcgatcacccatgcgctgcggaagatcccg
gcccgcatgtacgatctgcaacagcgagcgctcgaccagggcatggccgaggcgcgcaag
caggttgcccgtcacgtcaagaccgggcgcctgagcgaatccgcaagcgtcgagattctg
tcggctgtccggccgcagctgaatcttgccggaatcggcgacgccgatgccgtggtcgag
gcgatcgtcgagaacctggacgtcaagcgcaaggtcctcgctgatctggagccctcgctc
aaggaagaggcgatcctggtgtccaacacgtcaagtcttcgcatcgacgacatcgcggcg
ccgctcaagcgtcctgaacggtttgtcggcatgcatttcttcaacccggtcccgatgatg
ccgctcgtggaagtcgtgcgcggcacgcgtacctccgatcaagccgtggcgaccgcagtg
gcctacgcgacagcgctgggcaaaaccgccattgtcgtacgcgattgccccgggtttctc
gtcaaccgggtgctgaccgcatacatacgcggttttctgaagctgattgccgacggcgcg
gacttcgagcaggtcgacaaggtcatggagtcgttcggctggccgatggggccggcgtat
ctcgaagacgtggtcggcatggacacgggtagccatgtcaacaatgtcatttcggccggc
tatgcggaccgcatgcccgagctcgccgacgatgcgttgcgcgtgatggtgcgacatggc
cgcttcggtcagaagaacggcctgggcttttaccgctacgaggccagcgcgaccggcggc
aagccgcgacgtacgtcgtcgacggacgcacacgcgctgcttgcgcagctgcagtcggag
gggcgccggaattttaccgacgaagagatcgtcgaccgcatgatgctcccgatggtgctc
gaggcagcgcgaacgttgcacgaaggtgtggtcgcaaccgcggcggaagtggacctggcg
atgcagcttggtctcggcttccctgcctatgccggcggccccctcaagtatgccgactgg
ctgggcctggccgaagtggtgcaccgttgcgatgcgctgagtgcactggggccggcctat
gagcccggccagcgactgcgcgagatggcgtcggccaacgaccgcttctatccgattacc
cagtga

DBGET integrated database retrieval system