KEGG   Burkholderia cepacia GG4: GEM_4690Help
Entry
GEM_4690          CDS       T02205                                 

Definition
NAD-binding 3-hydroxyacyl-CoA dehydrogenase protein
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
bct  Burkholderia cepacia GG4
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GEM_4690
   01212 Fatty acid metabolism
    GEM_4690
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GEM_4690
   00650 Butanoate metabolism
    GEM_4690
  Lipid metabolism
   00071 Fatty acid degradation
    GEM_4690
   01040 Biosynthesis of unsaturated fatty acids
    GEM_4690
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GEM_4690
   00310 Lysine degradation
    GEM_4690
   00380 Tryptophan metabolism
    GEM_4690
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GEM_4690
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GEM_4690
   00281 Geraniol degradation
    GEM_4690
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    GEM_4690
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     GEM_4690
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GEM_4690
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     GEM_4690
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     GEM_4690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1670435..1672600)
Genome map
AA seq 721 aa AA seqDB search
MFQGQSLRVSPLGDNGIFELCFDRQGESINKFDRRTIDELRQANQYLLNQAGLRGVLVTS
AKNVFIVGADITEFGVKFAQPAAAIAADVAGSNDAFIQFEDLPVPSVVAINGFALGGGLE
FALTGAMRVMSSDAQIGVPEVKLGLFPGFGGTVRLVRIAGPAVACDWVAAGKPATPAAAF
AAGVVDDIASPDELRSRALHLLERAIANEVDWQALQDRKRKPLSAEVAAQAAAAFEQGRA
IAAERGSPHQPAALAAIDMMAEGAALDRAGALALEARVFGEIARTQAASSMVQTFLSEQA
VKKIARHREKGAGKVSGALVLGAGIMGGGIAITHALRKIPARMYDLQQRALDQGMAEARK
QVARHVKTGRLSESASVEILSAVRPQLNLAGIGDADAVVEAIVENLDVKRKVLADLEPSL
KEEAILVSNTSSLRIDDIAAPLKRPERFVGMHFFNPVPMMPLVEVVRGTRTSDQAVATAV
AYATALGKTAIVVRDCPGFLVNRVLTAYIRGFLKLIADGADFEQVDKVMESFGWPMGPAY
LEDVVGMDTGSHVNNVISAGYADRMPELADDALRVMVRHGRFGQKNGLGFYRYEASATGG
KPRRTSSTDAHALLAQLQSEGRRNFTDEEIVDRMMLPMVLEAARTLHEGVVATAAEVDLA
MQLGLGFPAYAGGPLKYADWLGLAEVVHRCDALSALGPAYEPGQRLREMASANDRFYPIT
Q
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcaagggcaaagcttgcgcgtctcgccgctaggcgataacggcattttcgaattg
tgcttcgatcgtcagggcgaatccatcaacaaattcgaccgcaggacgatcgacgaattg
cggcaggccaaccagtacctgctgaatcaggccggcctgcgaggcgtcctggtgacgagc
gcgaagaacgttttcatcgtcggagcggatatcaccgaattcggggtcaagttcgcgcag
ccggcggcggccattgccgcggacgtcgcgggaagcaacgacgccttcatccagttcgaa
gacctgccggttccttccgtggtggcgatcaacggcttcgcgttgggtggaggcctcgaa
tttgcgctgactggcgcaatgcgcgtcatgtcgagcgacgcgcagatcggtgtgccggaa
gtgaagctggggctgttccccggattcgggggcacggtccggctggtgcgcattgcgggg
cccgcggtggcgtgcgactgggttgccgccggcaaacctgccacgcctgcggccgccttc
gctgccggcgtggttgacgatatcgcgtcaccggacgaactgcggtcccgtgcgctccat
ttgctcgagcgggcgatcgcaaacgaagtcgattggcaggcgctgcaggatcgaaaacgc
aagccgctgtcagcggaagtggccgcacaagccgcggctgctttcgagcaaggtcgcgcc
atcgcagccgaacgtggctcgccgcaccagcctgccgcgctcgccgcaatcgacatgatg
gccgagggggcggccctcgaccgtgccggtgcgctggctctcgaagcgagagtgttcggc
gaaatcgcccgtacccaggccgcgtcgtcgatggttcagacctttctgagcgaacaggct
gtcaagaagatcgcgcgccaccgcgaaaaaggggctggcaaggtgtccggcgcgttggtg
ctgggcgcggggatcatgggcggcgggatagcgatcacccatgcgctgcggaagatcccg
gcccgcatgtacgatctgcaacagcgagcgctcgaccagggcatggccgaggcgcgcaag
caggttgcccgtcacgtcaagaccgggcgcctgagcgaatccgcaagcgtcgagattctg
tcggctgtccggccgcagctgaatcttgccggaatcggcgacgccgatgccgtggtcgag
gcgatcgtcgagaacctggacgtcaagcgcaaggtcctcgctgatctggagccctcgctc
aaggaagaggcgatcctggtgtccaacacgtcaagtcttcgcatcgacgacatcgcggcg
ccgctcaagcgtcctgaacggtttgtcggcatgcatttcttcaacccggtcccgatgatg
ccgctcgtggaagtcgtgcgcggcacgcgtacctccgatcaagccgtggcgaccgcagtg
gcctacgcgacagcgctgggcaaaaccgccattgtcgtacgcgattgccccgggtttctc
gtcaaccgggtgctgaccgcatacatacgcggttttctgaagctgattgccgacggcgcg
gacttcgagcaggtcgacaaggtcatggagtcgttcggctggccgatggggccggcgtat
ctcgaagacgtggtcggcatggacacgggtagccatgtcaacaatgtcatttcggccggc
tatgcggaccgcatgcccgagctcgccgacgatgcgttgcgcgtgatggtgcgacatggc
cgcttcggtcagaagaacggcctgggcttttaccgctacgaggccagcgcgaccggcggc
aagccgcgacgtacgtcgtcgacggacgcacacgcgctgcttgcgcagctgcagtcggag
gggcgccggaattttaccgacgaagagatcgtcgaccgcatgatgctcccgatggtgctc
gaggcagcgcgaacgttgcacgaaggtgtggtcgcaaccgcggcggaagtggacctggcg
atgcagcttggtctcggcttccctgcctatgccggcggccccctcaagtatgccgactgg
ctgggcctggccgaagtggtgcaccgttgcgatgcgctgagtgcactggggccggcctat
gagcccggccagcgactgcgcgagatggcgtcggccaacgaccgcttctatccgattacc
cagtga

DBGET integrated database retrieval system