KEGG   Burkholderia cepacia GG4: GEM_4737Help
Entry
GEM_4737          CDS       T02205                                 

Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bct  Burkholderia cepacia GG4
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    GEM_4737
Enzymes [BR:bct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     GEM_4737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1731703..1733160)
Genome map
AA seq 485 aa AA seqDB search
MLERGPWRDTVPNRSMGIKNLVSLPQGAKAFTHGIRSVSSHLFKRDMVLNKKGLIEAYFG
DGISVVCSSNVGGGSHVYAGFLDKPLAPNYWDNHHPEISQAGMERYYNEILEALGARALT
PQDQAPNRIEEANYNGLLTCLGNPPVAMLLPKKPGFPSKVVDRNGIERWECDMKNNSFLG
SPSGAKTTLDFSFIRPAMQRGLVVRDMCEALSIRRLAQQGHGEMRYEVRYRDHRSGKEEC
VRAERVILAAGGLGTVRLLLKSRDVEKGLAGMPRLGFEFGGNGDFFGVWKENSKSDLSKG
MPIASPFRLKDSKNERVIVLRASIQGLDGVPAPSFVKRWLRRQSVIIAFGGDNNNGTMEI
KRGRFKIKYRSKDNVIYGQINDELKDIQTITKTKVYAPRNPVTVHPIGGACLGTSNADGV
VGANGEVFDNPGLYVADAAALPMSPGGAPSLTIAAWSANVADRLISELENRGSPSKDQRT
VLKAT
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagcgcggcccctggagagacaccgttcccaaccggtcgatgggcattaagaat
ctggtgtctctgccgcagggcgccaaagccttcacccatggcatacgatccgttagttcc
catttattcaaacgcgatatggttctgaataagaaagggctcatcgaagcttatttcggc
gatggcatcagcgttgtttgctcgtccaatgtgggcggtggcagccatgtttacgcagga
ttccttgataaaccgctggctccaaactactgggataaccatcacccggaaatctcgcag
gccggcatggagcgctattacaacgagatccttgaagcccttggtgctcgcgcactcaca
ccacaagaccaagcgcccaaccggatcgaggaggcaaattataacggcctgctcacgtgc
ctgggcaacccaccggtcgccatgctgcttccaaaaaaaccaggatttccttccaaggtc
gtggataggaatggaatcgagcggtgggaatgtgacatgaagaacaatagcttcttgggc
tctccttcaggcgcaaagaccactctggatttctcgtttatccggccggccatgcaacgg
ggcctggtcgtcagggatatgtgcgaggccttgtcaatacgccgattggcgcaacaaggt
catggcgaaatgcgctatgaggtccgctaccgcgatcatcgaagcgggaaagaagaatgt
gtccgagcggagcgtgtcattctggccgcgggcggcttgggcaccgttcggctgctgctc
aagagccgcgacgtcgaaaagggcttggcagggatgccaaggctcggcttcgaattcggg
gggaatggcgatttcttcggagtctggaaggagaatagcaaatcagacctttcaaaaggc
atgcctattgcctcaccgttcaggctcaaggactcgaagaatgagcgcgtcattgtcctg
cgcgcgagcattcaaggcctggatggtgtaccggcaccttcctttgtcaagcgttggcta
cggaggcaatccgtcattatcgcttttggcggcgacaataataacggaaccatggaaatt
aaacgtggcagattcaagattaaatacaggtcaaaagacaacgtcatctatggtcagatt
aatgatgaactgaaggacatccagacgatcaccaagacaaaagtttacgcgcctcggaat
cccgtcacggtacatcccattggaggtgcctgcctgggcacctccaacgcggacggcgtg
gtaggtgccaatggagaggtattcgataatcccggattgtacgtcgccgatgccgccgcg
cttccgatgtcccccgggggggctcccagtctgaccatagctgcatggtcagccaacgtc
gccgaccgattgatctcagaattggaaaatcgcggctcgccaagcaaggatcagcggacg
gtgctgaaagccacctga

DBGET integrated database retrieval system