KEGG   Burkholderia cepacia: GEM_4740Help
Entry
GEM_4740          CDS       T02205                                 

Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bct  Burkholderia cepacia
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:bct00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1734851..1736980)
Genome map
AA seq 709 aa AA seqDB search
MVGDGLNDAPSLVAADVGSSMSAGADGAMEAAGITLMRGVPRRGATSYLLENQTYEYRRS
GHRLRRLGENDPALRRPRTVAAGEPHGQRLPATRRQGRGQTAVYRAMPRPRLLAGQGQRT
ARCTAAMATIRRTARSSSRSRPKHSCEIAPPTLTRERRCLRSGDRSLVRARAFREPAAAD
DDRGSTSEAGSSVLRQSGELSVAMENEVEILVIGSGFGGSISAKRFAEAGRNVLMLERGP
WRNTVPIRSTGIEDLSPLPQGVKAFTHGLRSVRSRFIEREFVFNKRGFVEVYVGDGINVI
CSSNVGGGSHIYAAVLGKPFNPGYWSNRHPEISQEGMDKYYDEILGFLAARPVSPHDMVP
NSFDQTNYDGELSNAGLRNSPVGILLPERPGEARKVVDRNGVERWESDMRNNSFLGSPSG
AKTTLDFAVLWPAIGHGLSVRDLCEVKSIHKLRRDGAGKMRYEVRYRDHRSGRDEHVFAE
HVVLAAGALNTVRLLLKSRDVERGLDGMPRLGFRFGTNGGFFGFWKENSERDLSAGTPLC
GPFRAKDSKSKSALMLRASIQGLDAVPIPKLIRKWLCKNSCMVAFGGDGSNGSMSLRRGK
FEVRYRKSENSVYQEIADEVKNIEAATNTTVYAPGTPITVQPIGGACLGTSNLDGVIGAN
GEIFDNPGLYVADASALPESPGAPPSLSIAAWSANVADRLLESLQCRDV
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggtcggtgacggactgaacgatgcgccgtctctcgtggcggctgacgttggctcgtcg
atgtcggccggcgccgacggcgcgatggaggcggcggggatcacgctgatgcgaggcgtc
ccgcgccggggggcgacgtcatatctacttgagaatcaaacctatgaatatcggcgaagc
ggccaccgcctccggcgtctcggcgaaaatgatccggcactacgaaggcctcggactgtt
gccgccggcgagccgcacggacaacggctaccggcgacacggcgacaaggacgtgggcag
actgcggtttatcgggcaatgccgagacctcggcttctcgctggacagggtcagcgaact
gctcgatgcactgctgcaatggcgacgatacgccggactgcccgatcatcgagtcgctca
cgtccaaagcattcgtgcgagatcgcgccgccaacactaacccgcgaaagacgctgtctg
agaagcggcgaccgctcgctcgttagagctcgagctttccgtgaaccggctgctgctgat
gatgatcgtgggtcgacgtcagaggctggttcgagcgtacttcgacaatcgggggaatta
agcgtggctatggaaaacgaagtggaaatattggtaataggaagtggctttggaggttct
atttccgcaaagcgatttgcggaggcaggacgaaatgttttaatgctcgagcgtgggcca
tggaggaataccgttcccattcggtcgaccggtatcgaggatttatcaccgctcccgcaa
ggggtaaaggcgtttacccatgggttacgatccgtcagatctcgttttattgaaagagaa
ttcgtttttaataaaagaggatttgtggaggtgtacgttggtgatggtataaacgttatt
tgctcttcgaatgttggtggtggtagccacatctatgccgctgtgctgggcaagcctttc
aatcctggatactggagcaatcgccatccggaaatttctcaggagggcatggataagtac
tacgacgaaattctgggatttcttgctgcgcggcccgtgtcgcctcatgacatggtgcca
aacagttttgatcaaacgaactacgatggtgaactatcgaatgcgggcctgagaaattca
cccgttggcatcctattgcctgaaaggccgggagaggctcgaaaagtggtcgatcggaac
ggggtcgagcgatgggaatccgacatgcggaataatagttttctgggatctccgtccggc
gcaaaaacgaccctggatttcgccgtcctttggcctgccatagggcatggactatcggtt
cgtgacttgtgtgaagtaaagtcaattcataagctgagaagggatggcgccggcaagatg
cgatacgaagttcgatatcgcgaccatcgaagcggacgggatgagcacgtgttcgcggaa
cacgtagtcctggctgctggagccttgaatacagttcgcttactgttgaaaagccgtgat
gtagagcgcggattggatggaatgcctaggctaggtttccggtttggtacgaacggggga
tttttcggattttggaaagaaaacagtgagagagatctttctgccggtacgccgctatgt
gggcccttcagggcgaaagactcgaaaagtaaatcagctctgatgcttcgcgccagcata
cagggattggatgccgtaccgattccaaagctgataaggaagtggttgtgcaagaactcc
tgtatggttgccttcggtggcgatggtagcaatggatcgatgtcgctgcgacgcggaaaa
ttcgaggtacgatacaggaaaagtgaaaacagtgtttatcaagaaattgcagatgaagta
aaaaatatagaagcggcaacgaatacaacggtatatgcgcctggcactccgataacggtt
caaccgatcggaggtgcttgtttgggcacatcgaatttggatggtgtgattggtgcgaac
ggtgagatttttgataaccctgggctatatgtcgcagatgcctctgctctcccggaatct
cccggggcgccgccaagtttgtcgatagctgcatggtccgccaacgttgcagatagactg
ttggaatcgctgcaatgtcgcgacgtatag

DBGET integrated database retrieval system