KEGG   Burkholderia cepacia: GEM_4786Help
Entry
GEM_4786          CDS       T02205                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bct  Burkholderia cepacia
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GEM_4786
   00052 Galactose metabolism
    GEM_4786
   00500 Starch and sucrose metabolism
    GEM_4786
   00520 Amino sugar and nucleotide sugar metabolism
    GEM_4786
Enzymes [BR:bct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GEM_4786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1786630..1787517)
Genome map
AA seq 295 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKPSHVNCFYVRQPEALGLGHAVLCAEK
LVHGEPFAVILADDLLHGEQPVLKQLVDVFDHYHSSVIGVETIAREDSRSYGVVEGREWE
EDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRRLKPGAGGELQLTDAVQSLLA
NEQVLAYRYFGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLRTCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggccgtgttcccggtcgccggtctcggcacgcggttcctcccg
gcaacgaaggcgagcccgaaggaaatgctgccggtcgtcgacaagccactgatccagtac
gcggtcgaggaggcgatcaacgccggtatcaccgagatgatcttcgtgaccgggcgcagc
aagcgcgcgatcgaggatcacttcgacaagtcgtacgagatcgaggccgaactcgaggcg
cgcggcaaggaaaagctgctcgagctcgtgcgcggcatcaagccgagccacgtgaactgc
ttctacgtgcgccagccggaagcgctcggcctcggtcacgccgtgctgtgcgcggaaaag
ctcgtgcacggcgagccgttcgcggtgattcttgcggacgacctgctgcacggcgaacag
ccggtgctcaagcagctcgtggacgtgttcgaccactatcacagctcggtgatcggggtc
gagacgattgcgcgcgaggacagccgctcgtacggcgtcgtcgaaggccgggagtgggaa
gaggacatcatcaagttgtcgggcatcatcgagaagccggcgccggaagacgcgccgtcg
aacctcggcgtggtcggccgctacgtgttcatgccgacgatcttcgatcacctgcgccgg
ctcaagccgggcgcgggcggcgaactgcagcttaccgacgccgtccagtcgctgctcgcg
aacgaacaggtgcttgcgtatcgctatttcggcacgcgtttcgattgcggcagcaagatc
ggctacctcaaggcgaccgtcgagctcgcgctccagcatccggaagtgagccgcgaattc
gaggcgtacctgcgtacctgcctgcccgcgctggctgctgtcgcataa

DBGET integrated database retrieval system