KEGG   Burkholderia cepacia GG4: GEM_4801Help
Entry
GEM_4801          CDS       T02205                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bct  Burkholderia cepacia GG4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GEM_4801
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GEM_4801
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GEM_4801
Enzymes [BR:bct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GEM_4801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(1806314..1807132)
Genome map
AA seq 272 aa AA seqDB search
MSSRIQQTFAALAEQGRKGLIPFITAGDPDPAKTVEFMHALAEGGADVIELGVPFSDPMA
DGPVIQRSSERALARGVTLKSVLADVKRFRETDPKTPVVLMGYANPIERMGVDAFATEAQ
AAGVDGVLVVDYPPEEAGVFAEKMRAAQIDPIFLLAPTSTDERIADVGKIASGYVYYVSL
KGVTGAGNLDVSSIAGKIPAIKSRVPVPVGVGFGIRDAETARAVAEVSDAVVIGSRLVQL
LESAAPEGAAAALKTFIAELRAALDGAGNTAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccgtatccagcagaccttcgccgcactcgccgaacaaggccgtaagggcctg
atcccgttcatcacggccggcgatcccgaccccgcgaagaccgtcgagttcatgcacgcg
ctcgccgaaggcggcgccgacgtgatcgagctcggcgtgccgttctcggacccgatggcc
gacggcccggtgatccagcgctcgtcggagcgcgcgctcgcgcgcggcgtcacgctgaag
agcgtgctcgccgacgtgaagcgcttccgcgagaccgacccgaaaacccccgtcgtgctg
atgggctatgcgaacccgatcgagcgcatgggcgtcgacgcgttcgcgaccgaagcgcag
gcggccggtgtcgacggcgtgctggtcgtcgactatccgcccgaagaagcgggcgtgttc
gccgagaaaatgcgcgccgcgcagatcgatccgatcttcctgctcgcgccgacgtcgacc
gacgaacgcatcgccgacgtgggcaagatcgcgagcggctacgtgtattacgtgtcgctc
aagggcgtgaccggcgccggaaatctggatgtttcgagcattgcgggtaaaatcccggcc
atcaagtcgcgcgtgccggttccggtgggcgtcggcttcggcatccgcgacgcagaaacg
gcgcgcgcagtggccgaagtgtcggacgccgtcgtgatcggcagccgcctggtgcagctg
ctcgagagcgccgcgccggagggtgccgccgccgcgctgaagactttcatcgccgagctg
cgcgccgccctggacggcgccggcaacacggcgcgataa

DBGET integrated database retrieval system