KEGG   Burkholderia cepacia GG4: GEM_4803Help
Entry
GEM_4803          CDS       T02205                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00260  Glycine, serine and threonine metabolism
bct00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01130  Biosynthesis of antibiotics
bct01230  Biosynthesis of amino acids
Module
bct_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GEM_4803
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GEM_4803
Enzymes [BR:bct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GEM_4803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFQ51191
UniProt: J7JJD3
Position
2:complement(1808035..1809228)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGVFVAETLIHALDELRTAYEKFRNDPDFVAEYERELKYFVGRPSP
IYHAQRWSEMLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECIVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIESTFYIIGTVAGPHPYPAMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDASVQLIGVEAAGDGLDTGRHAASLIAGSPGVLHGNRTYLLQDDNGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDEEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGLTL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccttcctgatgatcgcggccacttcggcccgtatggcggcgtattcgtcgcc
gagacgctgattcacgcgctggacgaactgcgcacggcgtatgaaaaattccggaacgac
cccgatttcgtcgcggaatacgagcgcgaactgaagtacttcgtcggccgtccgtcgccg
atctatcacgcgcagcgctggagcgagatgctcggcggcgcgcagatctacctgaagcgc
gaggacctgaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcgctgctc
gcgaagcggatgggcaagaagcgcgtgatcgccgagaccggcgccggccagcacggcgtc
gcgacggcgacgatctgcgcccgcttcgggatggagtgcatcgtctacatgggcgccgag
gacgtgcgccgccaggctgcgaacgtctaccggatgaagctgctcggcgcgacggtcgtg
ccggtcgaatcgggttcgcgcacgctgaaggatgcgctgaacgaagcgatgcgcgactgg
gtcacgaacatcgagagcacgttctacatcatcggcacggtcgcgggcccgcacccgtac
ccggcgatggtgcgtgacttccagcgcgtgatcggcgacgagtgcaaggtgcagatgcct
gaactcgccggccgtcagccggacgcggtgattgcgtgcgtcggcggcggctcgaacgcg
atgggcatcttctatccgtacatcgacgatgcgtcggtgcagctgatcggcgtcgaagcg
gccggcgacggcctcgacaccggccgtcacgcggcgtcgctgatcgccggcagccccggc
gtgctgcacggcaaccgcacctacctgctgcaggacgacaacggccagatcatcgagacg
cattcggtgtcggcaggcctcgactatccgggcgtcggccccgaacacgcatggctgaag
gacagcggccgcgcgcaatacgtgccgatcaccgacgaggaagcgctgaaggcgttccac
gactgctgccggatcgaggggatcatccccgcgctcgagtcgagccacgcgatcgcgtac
ggcgtgaagctcgcgccgacgttgccgaaggacaagatcctgctcgtcaacctgtcgggc
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcctcacgctctga

DBGET integrated database retrieval system