KEGG   Burkholderia cepacia GG4: GEM_4819Help
Entry
GEM_4819          CDS       T02205                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00020  Citrate cycle (TCA cycle)
bct00190  Oxidative phosphorylation
bct00650  Butanoate metabolism
bct01100  Metabolic pathways
bct01110  Biosynthesis of secondary metabolites
bct01120  Microbial metabolism in diverse environments
bct01130  Biosynthesis of antibiotics
bct01200  Carbon metabolism
Module
bct_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bct_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bct_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GEM_4819
   00650 Butanoate metabolism
    GEM_4819
  Energy metabolism
   00190 Oxidative phosphorylation
    GEM_4819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AFQ51207
UniProt: J7JAA6
Position
2:complement(1826986..1827354)
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLVLFFGAHDFSYEGWASIFS
AQWMKLATFVTLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaataaccgaatcggctcgaagcgtctcgtcgtcggcgctcactacggcctg
cgcgactggctcgcgcagcgcgtcaccgccacgatcatggcggtctacacggtcattctg
ctcgtcctgttcttcggcgcgcatgacttctcgtacgaaggctgggcgtcgatcttctcc
gcgcaatggatgaagctcgcgaccttcgtgacgctgctttccctcttctaccacgcatgg
gtcggcgtgcgcgacatctggatggactacgtgaagcccgtcggtgtgcgcctgctgctg
caatcgctgaccatcgtctggctgctcgcatgtgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system