KEGG   Burkholderia cepacia GG4: GEM_4819Help
Entry
GEM_4819          CDS       T02205                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bct  Burkholderia cepacia GG4
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GEM_4819
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GEM_4819
   00650 Butanoate metabolism
    GEM_4819
  Energy metabolism
   00190 Oxidative phosphorylation
    GEM_4819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1826986..1827354)
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLVLFFGAHDFSYEGWASIFS
AQWMKLATFVTLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaataaccgaatcggctcgaagcgtctcgtcgtcggcgctcactacggcctg
cgcgactggctcgcgcagcgcgtcaccgccacgatcatggcggtctacacggtcattctg
ctcgtcctgttcttcggcgcgcatgacttctcgtacgaaggctgggcgtcgatcttctcc
gcgcaatggatgaagctcgcgaccttcgtgacgctgctttccctcttctaccacgcatgg
gtcggcgtgcgcgacatctggatggactacgtgaagcccgtcggtgtgcgcctgctgctg
caatcgctgaccatcgtctggctgctcgcatgtgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system