KEGG   Burkholderia cepacia: GEM_5302Help
Entry
GEM_5302          CDS       T02205                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
bct  Burkholderia cepacia
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GEM_5302
Enzymes [BR:bct01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     GEM_5302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2356240..2357190
Genome map
AA seq 316 aa AA seqDB search
MHRELNQPMGGNEMPRFGGIATMMRLPQADTTDGLDVCFVGVPLDLGTSNRSGSRFGPRQ
IRTESVLLRPYNMATRAAPFDSLQVADIGDVATNPYDLKDSVRRIEEAYDEIVANGCRPI
TLGGDHTIAWPILRALHKKYGKVAVVHVDAHADVNDTMFGEKIAHGTPFRRAVEDGLLQC
DKVTQIGLRGTGYHAEDFDWCRQQGFTVVQAEACWNKSLAPLMAQVRERVGDTPVYLSFD
IDGLDPSFAPGTGTPEIGGLSVQQGLEIIRGMKGLNIVGADLVEVSPPYDPTGTTALVGA
NLAFEMLCVMPGVAYR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcgaactgaaccaaccgatgggcggcaacgagatgccgcgttttggcggcatc
gccacgatgatgcgcctgccgcaggccgacacgaccgacgggctcgacgtgtgtttcgtc
ggcgtgccgctcgacctcggcacgtcgaaccgctcgggttcgcgcttcggcccgcgccag
atccgcaccgaatccgtgctgctgcgcccgtacaacatggccacgcgcgcagcgccgttc
gattcgctgcaggtcgccgatatcggtgacgtcgcgaccaacccttacgacctgaaggat
tcggtgcgccgcatcgaggaagcgtacgacgagatcgtcgcgaacggctgccggccgatc
acgctcggcggcgaccacacgatcgcgtggccgatcctgcgcgcgctgcataaaaagtac
ggcaaggtcgccgtggtgcacgtcgacgcgcacgcggacgtgaacgacacgatgttcggc
gagaagatcgcacacggcacgccgttccgccgcgcggtggaagacggcctgctgcaatgc
gacaaggtcacgcagatcggcctgcgcggcaccggctaccacgcggaagatttcgactgg
tgccgccagcagggcttcacggtcgtgcaggcggaagcatgctggaacaagtcgctcgcg
ccgctgatggcgcaggtgcgcgaacgcgtcggcgacacgccggtctacctgagcttcgac
atcgacggcctcgacccgtcgttcgcgcccggcaccggcacgccggaaatcggcggcctg
tcggtgcagcagggtctcgagatcattcgcgggatgaaggggctgaacatcgtcggcgcg
gatctcgtcgaagtgtcgccgccgtacgatccgaccggcaccaccgcgctcgtcggcgcg
aacctcgcattcgagatgctctgtgtgatgccgggcgtcgcctaccgctaa

DBGET integrated database retrieval system